SecReT6
Protein ID: 387505155
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01120
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]261072..261620 [-]
Producthypothetical protein
NoteTssC
UniProt IDH6ML64
KEGG IDelr:ECO55CA74_01120
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-74, Aligned region: 2..180
Protein Sequence: 182 a.a.     [Download]
>gi|387505155|ref|YP_006157411.1| hypothetical protein ECO55CA74_01120 [Escherichia coli O55:H7 str. RM12579]
MKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRKDSDNAAFFSANSVQKPKHFPGKDAE
TNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLERELNTWIRQYVADQENPPADVRSRKPLRAA
KVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDRE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|387504934|ref|NC_017656.1|:c261620-261072 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
GTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAAAATCCCAACCGAGGTGC
TGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTTACCATGCGTAAAGACTC
TGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTCCGGGAAAAGATGCAGAA
ACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTTAGCGCACTACATCAAGG
TGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAAAGAGAGCTTAATACCTGGAT
CCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCAGACGTGCGCAGCCGCAAACCTCTGCGCGCTGCC
AAAGTTGAGGTTATGGATGTAGAAGGCGAACCCGGCTGGTACCAGGTTGCGCTAAGCGTGAGACCTCATT
TTAAATTTATGGGGGCAAATTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGGGAGTAA
 Primer design