SecReT6
Protein ID: 387505161
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01150
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]264782..266923 [+]
Productprotein VgrG
NoteTssI
UniProt IDH6ML70
KEGG IDelr:ECO55CA74_01150
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.00E-63, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 4.40E-27, Aligned region: 366..458
Protein Sequence: 713 a.a.     [Download]
>gi|387505161|ref|YP_006157417.1| protein VgrG [Escherichia coli O55:H7 str. RM12579]
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQFLSLEFQQILDKMAYLTIWQGDDVQR
RVKGVVTWFELGENDKNQKLYSMKVCPPLWRTGLRQNFRIFQNEDIASILGTILQENGVTEWSPLFSEPH
PSREFCVQYGETDYDFLCRMAAEEGIFFYEEHVQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLC
ISQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQHQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGW
RNNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTTLDNHFAVIPA
DRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQDSSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGK
EQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQILNIGVNQIQTVGVNQVETVGSNQIIK
VGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMK
ENTGQTAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVP
KDLPPGMPDMRQF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|387504934|ref|NC_017656.1|:264782-266923 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
ATGTCAACCGGATTACGTTTCACGCTGGAAGTGGACGGCCTGCCACCGGATGCTTTTGCGGTGGTCTCCT
TTCATCTGAACCAGTCACTCTCTTCGCTTTTTTCCCTCGATCTCTCTCTGGTCAGCCAGCAGTTTCTCTC
CCTTGAATTCCAGCAGATCCTCGACAAAATGGCCTACCTGACGATATGGCAGGGCGATGACGTACAGCGC
CGGGTGAAAGGTGTGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGAAGCTGTACAGCATGA
AGGTATGCCCGCCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGC
AAGCATCCTCGGCACGATATTGCAGGAAAACGGGGTGACCGAGTGGAGCCCGCTGTTCAGCGAGCCACAT
CCTTCCCGTGAGTTTTGTGTCCAGTACGGTGAGACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGG
AAGGCATCTTCTTTTATGAGGAGCACGTGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGATACCGT
GCGTTATCTGCCGGAGTCCTTTGAGATCCCCTGGAATCCGAACACCCGTACCGAGGTAAGCACCCTCTGC
ATCAGCCAGTTTCGCTACAGCGCACAAATCCGCCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAAC
GCCCCGGCTGGGCCGGACGTTTTGACCAGGAAGGCCAGCACCAGGATTACCAGCGCACACAGTATGAAGT
GTATGACTATCCCGGACGTTTCAAGGGCGCCCACGGGCAGAACTTTGCCCGCTGGCAGATGGACGGCTGG
CGAAACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCGCCGGAGATATGGCCGGGACGGCGAATTGTGC
TGACGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCAAGTGAACTGCACGGTGAGCA
GCCGCAGGCGGTGCCGGGACGCAGGGGTTCAGGCACCACGCTGGATAACCATTTTGCGGTAATACCGGCA
GACAGAACATGGCGACCACAGCCGTTGCTGAAACCGCTGGTGGACGGCCCGCAGAGCGCCGTCGTGACGG
GACCGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGCTA
TAACCCGTCAAACCAGGACAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGGTTTGGT
AACCTGGCGATACCGCGTGTGGGTCAGGAGGTCATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGA
TCATTATGGGGCGTACCTACCACCAGGAAAACCGCACACCCGGTAGCCTGCCGGGGACGAAGACGCAGAT
GACCATTCGTTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAA
GAACAGGTCTACATCCACGCGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACGGATGTGA
TAAACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATCCTGAACAT
TGGCGTTAATCAGATACAGACGGTTGGTGTCAACCAGGTGGAAACGGTAGGCAGTAACCAGATTATCAAA
GTGGGATCAAACCAGGTTGAAAAGGTGGGGATCATTCGTGCGCTGACGGTGGGTGTGGCGTATCAGACGA
CGGTCGGCGGCATTATGAATACCTCGGTGGCGTTGTTGCAGTCCTCACAGGTAGGGCTGCATAAATCACT
GATGGTGGGAATGGGCTACAGCGTCAATGTAGGGAATAACGTCACCTTCTCGGTGGGCAAGACGATGAAG
GAAAACACCGGACAAACAGCAGTTTATTCTGCCGGTGAGCATCTTGAACTCTGCTGTGGTAAGGCAAGGC
TGGTGCTGACGAAGGACGGAAGCATATTTCTTAATGGTACGCACATTCATCTGGAAGGGGAGTCGGATGT
GAACGGTGATGCGCCGGTGATTAACTGGAACTGTGGTGCCACACAACCTGTACCGGATGCGCCTGTGCCG
AAAGATTTACCCCCCGGAATGCCGGATATGCGGCAATTTTGA
 Primer design