SecReT6
Protein ID: 387505162
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01155
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]266999..271231 [+]
Producthypothetical protein
NotePAAR
UniProt IDH6ML71
KEGG IDelr:ECO55CA74_01155
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 229..243
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 325..361
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 353..384
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 434..472
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 458..492
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 498..537
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 542..577
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 584..620
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 626..661
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 667..697
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 701..718
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 729..762
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 784..806
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 823..835
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 870..903
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 950..987
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 1002..1013
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 1035..1048
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 1152..1170
RHS_repeat [PF05593], Evalue: 2.20E-64, Aligned region: 1165..1189
RHS [PF03527], Evalue: 1.70E-20, Aligned region: 369..382
RHS [PF03527], Evalue: 1.70E-20, Aligned region: 625..635
RHS [PF03527], Evalue: 1.70E-20, Aligned region: 949..958
RHS [PF03527], Evalue: 1.70E-20, Aligned region: 1149..1189
Protein Sequence: 1410 a.a.     [Download]
>gi|387505162|ref|YP_006157418.1| hypothetical protein ECO55CA74_01155 [Escherichia coli O55:H7 str. RM12579]
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPVLGAKVLPGETDLALPGPL
PFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFW
LARGGVAEQHSSQPLSALWQVLPEDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLT
GVVDGFGRTLAFHRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSL
VFPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGTQVRGFAYDAE
HAGRMVAHHYAGRPESRYRYDDTGRVTEQVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPD
GLRSSREYDEKGRLAAETSRSGETTRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTR
YEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWG
KAVSTTQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDE
GLITLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPE
TGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETARSFGGE
AYELATAWNTSGQLRSRHLNLPQLDRDYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDI
PYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHY
DSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQT
QQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEE
SQQWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPQALISPEGETAWQGEYDEWGNLLGETSAQH
LQQPYRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIDIKGGWNLYSYALNPVSWIDPLGLTQCDSEG
CNNDILFTGGSGPDNKILNELGPRDGIDGLGSQNMKMYSGLLGGDILKPGILGGLTLGSVTQRPSRTAEE
EVQAQIEYLAYKKRCEQKPDSNLSRCAAAIFQKSRKEDCLRMRQEWDDKWWPGKHADEIKNVKASLKNTL
IDVKKKMHAN
 
Nucleotide Sequence: 4233 bp     [Download]
>gi|387504934|ref|NC_017656.1|:266999-271231 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
ATGGGAGGAAAACCAGCGGCGCGGCAGGGTGACATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CAGGGGTGCTGATAGGTGCGCCGACGGGAGTGGCCTGTTCGGTGTGTCCGGGAGGGATTACCTATGCTAA
CCCGGTGAACCCGGTGCTGGGTGCGAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCCGGCCCGCTG
CCGTTTATTCTTTCCCGCGCCTACAGCAGCTACCGGACCAGAACACCCGCGCCGGTGGGGGTGTTTGGTC
CCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACTCAACGACAACGG
CGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAGTCGTTCTGG
CTGGCGCGGGGCGGGGTGGCGGAGCAGCACAGTTCGCAGCCGCTAAGCGCGCTCTGGCAGGTGCTGCCGG
AAGATGTTCGCCTGAGTCCGCATATGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTGGATACTCAA
CTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGGGTGCTGACG
GGCGTGGTGGATGGCTTCGGGCGGACGCTGGCCTTTCACCGGGCGGCGGAGGGTGATGTGGCGGGCGCGG
TGACGGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGTGCTGACCACACAGGCACAGCGGGCGGA
AGTATTCCGTAAACAGCGCGCCACGTCTTTATCTTCCCCTGCCGGTCCCCGTTCTGCTTCCTCTTCTCTG
GTTTTCCCCGACACGCTGCCCGCCGGTACAGAATACGGTGCCGATAACGGTATCCGGCTGGAGGCGGTAT
GGCTGACACACGACCCGGCATACCCGGATGAACTGCCCGCCGCGCCGCTGGCGCGCTACACGTACACGGC
CAGCGGAGAACTGCGGGCGGTGTATGACCGCAGCGGGACGCAGGTGCGCGGGTTTGCTTATGATGCGGAG
CACGCCGGGCGGATGGTGGCGCACCATTATGCGGGTAGGCCGGAGAGCCGCTACCGGTATGATGATACCG
GCCGGGTGACGGAGCAGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGGCAGGACCGTGTGAC
CATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAAGGCGAGGGTGGCCTGAAACGTGTTGTG
AAGAAGGAACATGCGGACGGGAGCATCACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGAAGGCACAGA
CGGATGCGGCGGGACGGCGGACGGAGTACAGCCTGCATATGGCGTCGGGTGCGGTGACAGCGGTGACGGG
GCCGGACGGCAGGACGGTGCGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCAGTGACGTACCCGGAC
GGGCTGCGCAGCAGCCGGGAGTATGATGAGAAGGGAAGGCTGGCGGCGGAGACCTCGCGCAGCGGAGAGA
CGACGCGGTACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGACGGGCAGTAC
AAAACAGATGGCATGGAGCCGTTACGGTCAGCTGCTGACCTTTACGGACTGCTCGGGGTACACGACGCGG
TATGAGTATGACCGGTACGGTCAACAAATCGCCGTTCACCGGGAAGAAGGCATCAGCACTTACAGCAGTT
ATAACCCGCGTGGCCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGTGAAACCCGTTATGAGTACAGCGC
CGCAGGCGACCTCACCGCTATCGTTGCCCCGGACGGCAGCCGCAGTGAGATACAGTATGATGCGTGGGGA
AAGGCCGTCAGCACCACGCAGGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGCGCATCACCG
TGCTGACCAACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTGGACAGGCTGACTGAACAGCG
CGGTTTTGACGGCCGGACGCAACGTTACCACTATGACCTGACCGGAAAACTCACGCAGAGTGAAGACGAG
GGGCTTATCACCCTCTGGCACTACGATGCGTCGGACCGCATCACGCACCGGACGGTGAACGGCGACCCGG
CAGAGCAGTGGCAGTATGATGAGCACGGGTGGCTAACCACCCTCAGCCATACCAGTGAAGGCCACCGGGT
GTCGGTCCACTACGGCTATGACGATAAAGGCCGCCTGACGGGTGAACGGCAGACGGTGGAGAACCCGGAG
ACGGGGGAGATGCTGTGGGAGCATGAGACGGGGCACGCGTACAGCGAACAGGGGCTGGCGACCCGTCAGG
AGCCGGACGGTCTGCCGCCGGTAGAGTGGCTGACGTATGGCAGCGGTTATCTTGCGGGGATGAAGCTGGG
CGGAACGCCACTGGTCGAGTACACGCGGGACCGGCTGCACCGTGAGACGGCCCGCAGCTTCGGCGGGGAG
GCATATGAACTTGCCACCGCCTGGAATACCAGCGGCCAGCTCCGGAGCAGGCACCTGAACCTTCCGCAGC
TTGACCGTGACTACGACTGGAACGACAACGGACAGCTAATCCGCATCAGCGGCCCGCAGGAGAGCCGGGA
GTACCGTTACAGTGACACGGGAAGGCTGACGGGCGTCCACACCACGGCAGCGAACCTGGATATCGATATC
CCGTATGCAACGGACCCGGCAGGAAACCGGCTGCCGGACCCGGAACTGCATCCGGACAGCACGCTCACGG
CGTGGCCGGATAACCGCATCGCGGAAGATGCGCACTATGTCTATCGCTACGATGAATACGGCAGGCTGGC
GGAGAAGACGGACCGTATCCCGGAAGGGGTTATCCGGATGCACGACGAGCGCACCCACCACTATCACTAC
GACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCACGGCGAACCACAGGTGGAGAGCCGGTACC
TCTATGACCCGCTGGGCCGCCGGACGGGAAAACGGGTGTGGCGGCGGGAGCGTGACCTGACGGGGTGGAT
GTCGCTGTCGCGTAAACCGGAGGAGACCTGGTACGGGTGGGACGGTGACAGGCTGACCACTGTACAGACC
CAACAGACAAGAATCCAGACGGTATACCAGCCGGGAAGCTTCACGCCGCTCCTGAGAATCGAAACAGAGA
ATGGTGAACAGGCGAAGGCGCGGCACCGTAGCCTGGCGGAGGTGTTGCAGGAGGACACGGGTGTGACGCT
ACCGGCGGAGCTGGCGGTGATGCTGGGGAGGCTGGAGCGGGAACTGCGGCAGGGCAGCGTGAGTGAAGAA
AGCCAGCAGTGGCTTGCGCAGTGCGGGCTGACGGCGGAACAGATGGCCGCGCAGCTGGAGGCGGAATATA
TCCCGGAGCGGAAACTTCATCTTTACCACTGCGACCACCGGGGACTGCCGCAGGCGCTCATCAGCCCGGA
AGGGGAAACGGCGTGGCAGGGGGAGTATGACGAGTGGGGAAACCTGCTGGGCGAAACCAGCGCGCAGCAC
CTGCAACAGCCGTACCGTCTGCCGGGACAGCAGTATGATGAGGAGTCGGGGCTGTATTACAACCGTCACC
GGTACTATGACCCGCTACAGGGGAGGTATATCACCCAGGATCCAATAGATATAAAAGGAGGATGGAATTT
ATATTCTTATGCGCTTAATCCGGTAAGTTGGATTGACCCATTAGGATTGACGCAGTGCGATTCCGAAGGG
TGTAATAATGATATATTATTTACAGGAGGAAGTGGTCCCGATAATAAAATACTTAATGAATTAGGTCCGA
GAGATGGCATTGACGGTTTGGGTTCACAAAACATGAAAATGTATAGTGGGCTATTAGGGGGCGATATTTT
AAAACCGGGGATTCTGGGCGGTTTGACGCTTGGTAGTGTGACACAACGACCATCGCGAACGGCTGAGGAG
GAGGTGCAAGCTCAAATAGAATATTTAGCATATAAGAAGCGTTGTGAGCAAAAACCTGATAGTAATTTAA
GTCGTTGTGCTGCCGCGATCTTTCAAAAGAGCAGAAAAGAAGATTGTTTAAGAATGAGACAAGAATGGGA
TGATAAATGGTGGCCTGGCAAACATGCGGATGAAATAAAAAATGTGAAAGCATCGTTGAAAAACACACTT
ATTGATGTTAAAAAAAAGATGCATGCCAACTAG
 Primer design