SecReT6
Protein ID: 387505182
SecReT6 ID635
T6SS typei1
Gene symbol-
Locus tagECO55CA74_01255
StrainEscherichia coli O55:H7 str. RM12579
Repliconchromosome [GenBank: NC_017656] [Browse all T6SS(s) in this replicon]
Location [Strand]289136..289921 [+]
Producthypothetical protein
NoteTagL
UniProt IDH6ML91, H6ML91
KEGG IDelr:ECO55CA74_01255
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.00E-15, Aligned region: 69..87
OmpA [PF00691], Evalue: 4.00E-15, Aligned region: 120..213
Protein Sequence: 261 a.a.     [Download]
>gi|387505182|ref|YP_006157438.1| hypothetical protein ECO55CA74_01255 [Escherichia coli O55:H7 str. RM12579]
MTTIKLIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPATVAVPEETEKKARDVNEKTAL
LKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQNRNMFERGSAQIMPFFKTLLVELA
PVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRALSARRVLEEAGMPEDKVMQVSAMADQMLLDAKNP
QSAGNRRIEIMVLTKSASDTLYQYFGQHGDKVVQPLVQKLDKQQVLSQRTR
 
Nucleotide Sequence: 786 bp     [Download]
>gi|387504934|ref|NC_017656.1|:289136-289921 Escherichia coli O55:H7 str. RM12579 chromosome, complete genome
GTGACGACGATAAAGTTGATTGTCAACAGCGTCAGTAAATCCGAGCGTGAAAGCATTATCGCCGCGCTGC
ACGGGCAGTCGATTTTTAACGGTGGTGGGCTGTCGCCGTTAAATAAAATCAGCCCGTCTCATCCGCCAAA
ACCTGCCACCGTGGCGGTGCCGGAAGAGACGGAGAAAAAAGCGCGTGATGTGAATGAGAAAACGGCGCTG
CTGAAGAAGAAATCCGCCACCGAGCTTGGCGAGCTGGCAACCAGTATCAACACCATTGCCCGTGATGCGC
ATATGGAAGCGAATCTGGAGATGGAGATTGTCCCGCAGGGATTACGCGTGCTGATTAAAGACGACCAGAA
TCGCAATATGTTCGAACGCGGCAGCGCGCAGATTATGCCGTTCTTTAAAACTTTGCTGGTGGAGCTCGCG
CCAGTGTTCGACTCGCTCGATAACAAAATTATTATTACCGGGCATACCGATGCGATGGCCTACAAAAACA
ATATCTACAACAACTGGAACCTTTCGGGCGATCGCGCGCTTTCAGCTCGTCGGGTGCTGGAAGAGGCCGG
AATGCCGGAAGATAAAGTGATGCAGGTAAGCGCAATGGCGGACCAGATGCTGCTGGACGCGAAAAATCCG
CAAAGCGCGGGCAACCGACGCATTGAGATTATGGTGCTGACCAAAAGTGCGTCCGATACGCTGTATCAAT
ACTTTGGTCAGCATGGGGATAAAGTGGTGCAGCCGCTGGTGCAAAAGCTGGATAAGCAGCAGGTGCTTTC
GCAGCGAACGCGCTAA
 Primer design