SecReT6
Protein ID: 387605689
SecReT6 ID485
T6SS typei1
Gene symbol-
Locus tagEC042_0212
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]245395..248922 [-]
Productputative type VI secretion system protein
NoteTssM
UniProt IDD3GS47
KEGG IDelo:EC042_0212
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.60E-83, Aligned region: 508..820
ImcF-related_N [PF14331], Evalue: 1.00E-60, Aligned region: 210..458
ImcF-related_N [PF14331], Evalue: 1.00E-60, Aligned region: 837..883
DUF1215 [PF06744], Evalue: 3.50E-32, Aligned region: 304..323
DUF1215 [PF06744], Evalue: 3.50E-32, Aligned region: 916..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|387605689|ref|YP_006094545.1| putative type VI secretion system protein [Escherichia coli 042]
MFRFPTSRLFSTLRSALRPAMPRFRVSAAWLLALAWIFLLVWIWWQGPKWTLYEQHWLAPLTNRWLATAV
WGLIALIWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYM
VIGPAGSGKSALLREGFPSDIIYTPESIRGTEYHPLITPRVGNQAVIFDVDGVLTSPGGDDLLHRRLREH
WLGWLMQTRARQPLNGLILTLDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLTG
FAALFHSLDKKDRDAILGVTFTRRAHESDDWRSELGAFWQTWVQQVNLALSDLMLAQTGAAPRSAVFSFS
RQMQGTGEIVTALLAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTP
YFTRRLFPEVLLAEPNLAGENSVWLNSSRRRLTAFSACGAALAALLVGSWHHYYNQNWQSGVNVLAQAKA
FMDVPPPQGTDEFGNLQLSLLNPVRDATLAYGDYRDRGFLADMGLYQGVRVGPYVEQTYIQLLEQRYLPS
LMNGLIRDLNNAPPESEEKLAVLRVLRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMAHLDYAL
EHTDWHAQRQSGDSDAVSRWTPYDKPVINAQQELSKLPIYQRVYQTLRTKALSVLPADLNLRDQVGPTFD
NVFVAGNDEKLVIPQFLTRYGLQSYFVKQREGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYIS
DYTATWRAGMDNLNVRDYEAMSALTDALEQIISGDQPFQRALTALRDNTHALTLSGKLDDKAREAAINEM
DYRLLSRLGHEFAPENSALEEQKDKASTLQAVYQQLTELHRYLLAIQNSPVPGKSALKAVQLRLDQNSSD
PIFATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPRATQDAS
LDSFERFFKPDGILDNFYKNNLRLFLENDLTFGDDGRVLIREDIRQQLDTAQKIRDIFFSQQNGLGAQFA
VETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGRAPHSIAFSGPWAQF
RLFGAGQLTNVTSDTFNVRFNVDGGAMVYRVHVDTEDNPFTGGLFSLFRLPDTLY
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|387605479|ref|NC_017626.1|:c248922-245395 Escherichia coli 042, complete genome
GTGTTCAGATTTCCGACATCCCGACTGTTCAGCACGCTGAGATCTGCTCTCAGGCCAGCGATGCCGCGAT
TCAGGGTATCCGCCGCCTGGCTGCTGGCGCTGGCATGGATTTTTCTGCTGGTGTGGATCTGGTGGCAAGG
TCCGAAATGGACGCTCTATGAGCAGCACTGGCTGGCTCCTCTAACAAACCGCTGGCTGGCGACCGCCGTC
TGGGGGCTTATCGCTCTGATCTGGCTCACCTGGCGGGTAATGAAGCGTCTGCAAAAGCTGGAAAAACAGC
AGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGCAATATCTGGA
TCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCCGTGGTATATG
GTCATTGGTCCTGCGGGTAGCGGTAAAAGCGCTCTGCTGCGCGAGGGCTTTCCATCTGACATTATTTACA
CGCCGGAAAGCATCCGGGGTACGGAATACCATCCGCTGATCACACCGCGAGTGGGCAACCAAGCGGTGAT
TTTCGATGTTGACGGCGTACTGACCTCGCCCGGCGGGGATGATCTGCTCCACCGCCGCCTGCGCGAACAC
TGGCTGGGCTGGCTGATGCAAACGCGCGCGCGCCAGCCGCTCAACGGCCTGATCCTGACGCTCGATCTTC
CCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGCAACTTCAGGA
GATCCGCCAGAGTCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCTGCTGACCGGC
TTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACGTTTACCCGCC
GCGCCCATGAAAGTGACGACTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTACAACAGGTGAA
CCTGGCGCTGTCGGATCTGATGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCCGTGTTCAGCTTCTCC
CGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGTGAGAACATGG
ATGTAATGCTGCGTGGCGTCTGGCTCACATCATCGCTACAGCGTGGCCAGGTGGATGATATTTTCACGCA
GTCCGCCGCCCGCCAGTACGGGCTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGAGACGACGCCG
TATTTTACTCGCCGCCTCTTCCCTGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAAAACAGCGTCT
GGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCGCCTGTGGCGCGGCGCTGGCGGCATTGCTGGT
CGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTCCGGCGTTAACGTACTGGCACAGGCTAAAGCC
TTTATGGACGTACCACCACCGCAAGGAACGGATGAATTCGGCAATCTGCAACTGTCGTTGCTTAATCCGG
TACGCGATGCCACCCTGGCCTATGGCGATTACCGCGATCGCGGTTTTCTGGCGGATATGGGATTGTACCA
GGGCGTCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTATCTCCCCTCG
TTAATGAACGGCCTGATCCGGGATCTAAACAATGCCCCGCCAGAGAGCGAAGAAAAGCTCGCCGTGCTGC
GCGTACTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACATGGCGCGGCG
CTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGCGCATCTGGACTATGCGCTG
GAGCACACCGACTGGCACGCGCAGCGCCAGAGCGGTGACAGCGATGCTGTCAGCCGCTGGACCCCCTATG
ATAAACCGGTCATTAATGCGCAGCAGGAACTGAGCAAGCTGCCCATATACCAGCGTGTCTACCAGACCCT
GCGCACCAAAGCATTAAGCGTGTTGCCCGCCGATTTGAATTTGCGCGACCAGGTTGGTCCCACCTTCGAC
AACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTCCTCACCCGCTATGGACTGCAAA
GCTATTTTGTCAAACAGCGTGAGGGCCTCGTTGAGCTGACCGCGCTGGATTCGTGGGTACTGAACCTGAC
GCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACCGAACAGTACATCAGT
GACTATACCGCCACCTGGCGTGCCGGAATGGATAACCTCAACGTCCGTGACTATGAGGCCATGTCGGCGC
TGACCGACGCGCTGGAGCAGATTATCAGCGGCGATCAGCCATTCCAGCGTGCGCTGACGGCGCTGCGCGA
TAATACCCACGCGCTGACGCTCTCCGGCAAACTGGATGATAAGGCGAGGGAAGCGGCAATAAATGAGATG
GATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCACCGGAAAACAGCGCACTGGAGGAGCAAAAGG
ACAAGGCGAGTACGCTACAGGCCGTGTACCAGCAACTGACCGAGCTGCACCGTTACCTGCTGGCGATCCA
GAACTCGCCAGTGCCGGGGAAATCGGCGCTGAAAGCAGTACAGCTACGTCTGGATCAAAACAGCAGCGAT
CCAATCTTCGCTACCCGCCAGATGGCAAAAACTCTCCCTGCACCGCTTAACCGCTGGGTAGGTAAGCTCG
CGGATCAGGCCTGGCATGTGGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGCGCGACAATGT
AGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCGCGCCACACAGGATGCCTCA
CTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAACAACCTGCGCC
TGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAGTGTTAATCCGTGAAGATATCCGGCAGCA
ACTGGATACCGCGCAGAAAATCCGCGACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGCACAGTTTGCC
GTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAGTTAGTGGACT
ACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAAGCAA
GCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCACAGTATCGCGTTCAGTGGACCGTGGGCGCAGTTC
CGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTTAACGTGGACG
GCGGCGCAATGGTTTACCGGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCT
GTTCCGTTTACCGGATACGTTGTATTAA
 Primer design