SecReT6
Protein ID: 387609960
SecReT6 ID463
T6SS typei2
Gene symbol-
Locus tagEC042_4539
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4870248..4873637 [+]
Productputative type VI secretion protein
NoteTssM
UniProt IDD3GUX0
KEGG IDelo:EC042_4539
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.50E-69, Aligned region: 409..725
IcmF-related [PF06761], Evalue: 2.50E-69, Aligned region: 762..762
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 846..965
Protein Sequence: 1129 a.a.     [Download]
>gi|387609960|ref|YP_006098816.1| putative type VI secretion protein [Escherichia coli 042]
MNKLACLSGRFGRPGIVFIGVAALWWLITRYGAYLGAETRRDQILLLILLSLGVLFVCYLPVMKKYVQEL
TYRRRARKEQRLPDDEERLAQTPPRYVTVQDIRHTLRRQYGRFWGRKIRILLITGTASEVELLTPGLTEQ
FWQEEQGTLLLWGGDPSQPENADWLAALRRLRYRPADGIVWVTSGLSETLSAPLTEDALDRVSRAVSSCC
ERLGWRLPLYVWSLQESPDERGRITQPVGCLLPAECSSDKLKAQLQAMLPGLVAQGIQQICCAPRYYFLL
SLAERFRRNIDAVVEPLSVLLRPYRQLLLAGIVFSPATVGGERSVRHRWRMDNRWEALPETVQQLPVRLQ
PSRTGHNWRRSLAVMAAILMMAQGTGMVVSFLANRSLVAEVQEQIRPAQNQQLSPAERLQALLNLQKSLA
RLQYREEHGAPWYLRAGMNQNADLLAVVMPLYAQNAHLLLRDAAAAHLEQQLRTFIRLPPDSPQRGKMAK
AAYDQLRLYLMLAQPQHMEPAWFSRTLMREWPQRDGVSAVFWQANGPTLLAYYASGIITHPQWKLTADEE
LVSQSRTLLLRHLGTQNSDAMLYQKMLARVAHQFADMRLTDMTGDTDVSRLFFTDEVVPGMFTRQAWEEA
VLPSIDTVINERREEMDWVLTDGRQKAPSPVSPEALRQRLTTRYFADFGNAWLNFLNSLHLRKAQTLSDV
TEQLTLMADVRQSPLVALMNTLAVQGCTGQPREAVTDSLVKSARNLLSQEKQPVAVPESRLHGPLATTFG
PVLALMDNQNNSADMLNLQTYLTRVTQVRLRLQQIAGSSDPQAMMQLLAQTVLQGKSVDLTDTRDYGSLT
AAGLGQEWYGFGQTVFVRPMEQAWQQVLTPAAESLNARWRTAVVDGWNNAFSGRYPFKNVSSDASLPLLA
KYLNTDTGRIARFLQNNLSGVLHREGSRWVPDTINTRGLTFNPAFLKAINTLSEIADVAFTTGNAGLHFE
LRPGTAAGVMQTTLITDNQKLIYVNQMPVWKRFTWPADTEAPGASLSWVSTQAGTRQYADLPGSWGLIRL
LEMARRKAAPGVASGWSLSWQAQDGRMLNYTLRTEAGEGPLVLLKLRNFVLPETVFELSGTSAFTGNDED
AGDTVEETD
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4870248-4873637 Escherichia coli 042, complete genome
ATGAATAAACTGGCCTGTCTGTCTGGTCGCTTTGGGCGACCGGGGATTGTATTTATTGGTGTGGCTGCGC
TCTGGTGGCTGATAACCCGATATGGAGCATATCTGGGGGCAGAAACACGCCGGGATCAAATACTACTGCT
GATATTGCTGAGTCTGGGGGTGCTCTTTGTCTGTTACCTGCCTGTGATGAAAAAATATGTTCAGGAACTG
ACATATCGACGCAGGGCCCGTAAGGAGCAAAGGTTACCTGACGATGAAGAGCGATTGGCTCAGACGCCAC
CGCGCTATGTTACTGTTCAGGATATTCGTCATACTCTGCGGCGCCAGTATGGCAGATTCTGGGGACGTAA
GATACGCATTCTGTTGATAACAGGTACCGCCTCTGAGGTTGAGTTGTTGACCCCGGGCCTGACAGAACAG
TTCTGGCAGGAAGAGCAGGGGACATTGCTTCTCTGGGGAGGAGACCCCTCGCAGCCGGAAAACGCAGACT
GGCTGGCTGCGTTACGCCGTCTGCGTTACCGGCCTGCTGATGGCATTGTCTGGGTAACTTCCGGACTGAG
TGAAACATTATCCGCACCACTGACAGAAGATGCCCTGGACAGGGTTTCCCGTGCGGTCAGTTCATGTTGT
GAGCGCCTTGGCTGGCGTCTGCCGCTGTATGTCTGGTCACTGCAGGAGAGTCCGGATGAGCGAGGGCGTA
TTACTCAGCCCGTGGGATGCCTTCTGCCAGCAGAATGTAGTTCTGACAAACTGAAAGCACAACTACAGGC
CATGCTCCCCGGGCTTGTTGCTCAGGGGATACAGCAGATATGCTGTGCCCCTCGGTATTATTTTTTGTTG
TCGCTGGCAGAGCGATTCAGACGAAATATTGATGCTGTGGTGGAGCCATTATCCGTATTACTCCGTCCAT
ACCGTCAGTTGTTGCTGGCGGGTATTGTTTTCAGTCCGGCAACTGTCGGCGGTGAACGAAGTGTCAGACA
TCGCTGGCGAATGGATAACCGCTGGGAGGCGTTGCCGGAGACAGTGCAGCAATTACCTGTCCGGCTACAG
CCTTCCCGCACAGGTCATAACTGGCGCAGAAGTCTGGCCGTTATGGCGGCCATACTGATGATGGCTCAGG
GAACAGGAATGGTGGTTTCCTTTCTGGCAAACCGGAGTCTGGTTGCTGAAGTACAGGAACAGATTCGTCC
GGCTCAGAACCAGCAACTGTCTCCTGCAGAACGTCTGCAGGCGTTGCTGAATCTGCAGAAATCCCTGGCC
CGCCTTCAGTACCGGGAGGAGCACGGGGCGCCATGGTACCTGCGGGCCGGTATGAATCAGAATGCAGACC
TGCTCGCGGTCGTAATGCCCCTTTATGCACAAAATGCACATCTTTTACTGCGTGATGCCGCTGCTGCTCA
TCTTGAGCAGCAGCTCAGGACATTTATTCGTCTTCCTCCGGACAGCCCGCAGCGGGGGAAAATGGCAAAA
GCCGCATATGACCAGCTCAGACTGTATCTGATGCTGGCGCAACCGCAACATATGGAGCCCGCCTGGTTCA
GTCGTACGCTCATGCGGGAATGGCCACAGCGTGACGGTGTGAGTGCCGTTTTCTGGCAGGCTAATGGCCC
GACGTTGCTGGCGTATTATGCCTCCGGGATTATTACTCATCCTCAGTGGAAGCTGACGGCTGATGAAGAG
CTGGTCAGCCAGAGCAGAACTCTGCTGCTTCGCCATCTGGGAACACAGAACAGCGATGCCATGCTGTATC
AGAAAATGCTGGCACGGGTGGCACATCAGTTTGCGGATATGCGTCTGACGGATATGACCGGTGATACTGA
TGTCTCCCGCCTCTTTTTTACGGATGAAGTGGTTCCCGGTATGTTTACCCGCCAGGCCTGGGAAGAGGCC
GTATTGCCGTCGATAGACACCGTGATTAATGAGCGTCGTGAAGAAATGGACTGGGTACTGACGGATGGCA
GGCAGAAGGCACCGTCACCGGTATCGCCGGAAGCACTCAGACAGCGCCTGACAACGCGCTATTTTGCTGA
TTTTGGTAATGCCTGGCTGAATTTTCTGAACAGTCTGCACTTGCGTAAAGCTCAGACGCTGTCTGATGTG
ACAGAGCAACTGACGCTTATGGCTGATGTGCGCCAGTCCCCCCTGGTTGCTCTGATGAATACGCTGGCGG
TTCAGGGGTGTACTGGCCAGCCCCGGGAAGCGGTTACTGATTCACTGGTTAAATCTGCCAGAAACCTGCT
TTCACAGGAAAAACAGCCAGTGGCAGTACCGGAAAGCCGGCTTCACGGTCCTCTGGCGACGACTTTCGGG
CCGGTGCTTGCACTGATGGATAATCAGAACAACAGTGCGGATATGCTGAATCTGCAGACATATCTGACCC
GGGTGACACAGGTTCGTCTGCGTCTGCAACAGATTGCCGGCTCTTCTGACCCGCAGGCCATGATGCAGTT
GCTGGCACAGACAGTATTGCAGGGGAAATCGGTTGATTTAACCGATACCCGGGATTACGGCAGCCTGACC
GCTGCCGGACTCGGACAGGAGTGGTATGGCTTCGGACAGACGGTCTTTGTTCGCCCGATGGAGCAGGCGT
GGCAGCAGGTTCTTACGCCCGCGGCAGAAAGTCTGAATGCCCGGTGGCGTACTGCGGTGGTGGATGGCTG
GAATAATGCATTTTCCGGGCGTTATCCGTTTAAAAATGTCAGCAGCGATGCTTCGCTTCCCCTGCTGGCA
AAATACCTGAATACGGACACGGGACGTATTGCCCGTTTCCTGCAGAATAACCTGAGTGGTGTGTTGCACA
GGGAAGGCAGTCGCTGGGTACCTGATACCATTAATACCCGGGGACTGACATTCAACCCTGCGTTTCTGAA
AGCCATCAATACCCTGAGTGAAATAGCGGATGTGGCGTTCACCACAGGTAACGCGGGGCTGCATTTTGAG
CTGCGCCCGGGAACTGCTGCCGGTGTGATGCAGACGACGCTGATAACCGATAATCAGAAACTGATTTATG
TTAATCAGATGCCGGTATGGAAGCGATTTACCTGGCCGGCTGATACGGAAGCACCTGGCGCCAGTTTAAG
CTGGGTAAGCACTCAGGCCGGTACCCGTCAGTATGCAGACCTGCCGGGAAGCTGGGGGCTGATACGTCTG
CTTGAGATGGCCCGACGGAAAGCCGCACCGGGCGTTGCCAGTGGCTGGAGCCTGAGCTGGCAGGCGCAGG
ACGGTCGTATGCTGAATTACACACTGCGAACTGAAGCGGGGGAAGGGCCGCTTGTATTGCTGAAACTCCG
CAATTTTGTTCTGCCGGAAACGGTTTTCGAACTCTCCGGCACGTCAGCGTTTACAGGCAATGACGAAGAT
GCCGGGGATACCGTGGAGGAGACTGACTGA
 Primer design