SecReT6
Protein ID: 387609992
SecReT6 ID464
T6SS typei4b
Gene symbol-
Locus tagEC042_4576
StrainEscherichia coli 042
Repliconchromosome [GenBank: NC_017626] [Browse all T6SS(s) in this replicon]
Location [Strand]4905477..4908890 [+]
Productputative type VI secretion protein
NoteTssM
UniProt IDD3GV03
KEGG IDelo:EC042_4576
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.30E-13, Aligned region: 180..341
Protein Sequence: 1137 a.a.     [Download]
>gi|387609992|ref|YP_006098848.1| putative type VI secretion protein [Escherichia coli 042]
MIFMLKKTFSLFLWFFVSVFVLSVCYVIGVFRNWTDTTTALYWISVILVTLSFKFIMDCIHNYFSAGKYR
NFLKSFSRKKRALTLDSYFKKGLNIISKRGRGEVPWFLLTGDSEKNNSLLEDINLPVFHRNCVNSTPQQF
RTIRWWFFRDLSVLELSGKIYDNPGVINSVISSLSARKCKKQPPRGVVLVISADKLINHDYTYIRTLSQK
TRSFVEQLSLHLHHNIPVFIVISGCEHISGYSVLAQKIYQKHEKWHPVFWATNKSGTNASEYDSSYILSS
LRSNIMASICHALDDSLSDKEKNDILQFPDRLKGLKYSLDIFISTFCIENVFFSQTEIAGICLSGELMGE
KDKNCIFADILISEILPQIHDSDVIHVNKQRVNVSFKSVIAMTALCFVGYSGYCSYNVYNIRHGSVDTSH
AFLTEQISKYEDKVRSNMRYFPFKPALDDKYLFFRESLHKTTRFDISPVSWRVTEYKKNFMQASPSGKRE
LILSLSSSLISWDKMMKDESLSDLAKSPGIHELLKITRPHDKISSIASLAVERDEIQKNNGIENIYVFRN
LLTELVQSDPSYSWFVSEDVNIPAVRITDFWEDENSSVYLSGIWTQPGQNKLHQWYETIKEAYGRDTVPE
AFSSFVLYLDESRQEHFRQFIMSVARARKDSHSGLMNPLQLTNIIHNRSSEHRFFQFVDDELHNIPTSSA
QDWLSEFRLLNHLFSLKVDNGMKRQIEQFDLMLRIYLISVLNNSQMNRTLTHVTTWRSWQNALRNAVNSV
LHTASSVELIRNAMRSDPENKLVILFDEFEKVRSVINSNNREPVIDSVWDIYERQIYQLLDHAVTYTGCW
VGEQWRNSVLGRFNSGKHNLSYSEMQGKVYKDIIGFLKGPSNGVLALDPDGVRLLSFRERSIPFSPSFIT
FINDIVSPDDLLDVWLRERTQNKDELINVQGQLDLLNQTLQNAESQPYRVTIDSAPATIPDNPRVKPTGT
TLTLECKTGNSSIRSMNFADSGIFTWYPGSCHSVRIDILFPNFSATYKFTGETAWIDFINKFSDGESELM
TKDFSPESRNFLESMGIKGILVRYKLSDTGNLSQAYIEWEQLKQEKDKLKDLQVNLSNKLLTTHSWEKSA
WISRLPGNITICPVVQE
 
Nucleotide Sequence: 3414 bp     [Download]
>gi|387605479|ref|NC_017626.1|:4905477-4908890 Escherichia coli 042, complete genome
ATGATTTTTATGCTTAAGAAGACATTTTCATTATTTCTCTGGTTTTTTGTTTCTGTCTTCGTTCTGTCTG
TTTGCTATGTTATCGGCGTGTTCAGAAACTGGACAGATACTACAACTGCACTTTACTGGATTTCTGTGAT
TCTTGTTACTCTTTCCTTTAAATTTATTATGGATTGTATCCATAATTACTTTTCTGCAGGAAAATACAGA
AATTTTCTAAAGTCTTTCTCTCGTAAAAAGAGAGCATTGACGCTTGATTCGTATTTCAAAAAAGGTCTGA
ATATCATAAGTAAAAGGGGAAGAGGAGAGGTTCCTTGGTTCTTACTTACGGGAGATTCAGAAAAAAACAA
CTCTTTGCTTGAAGATATCAATCTTCCTGTCTTTCACCGTAATTGTGTAAATAGCACTCCCCAACAATTC
CGGACAATTCGTTGGTGGTTTTTCAGAGATTTAAGCGTGCTGGAGTTGTCAGGAAAGATATATGATAACC
CGGGAGTAATAAACTCTGTGATAAGTTCTTTATCAGCACGTAAATGTAAAAAACAGCCACCTCGTGGCGT
TGTTCTCGTCATTTCTGCTGATAAGCTAATTAATCATGATTACACCTATATTCGGACATTGTCTCAAAAA
ACAAGGAGTTTTGTAGAACAACTGTCGTTACACTTACATCACAACATTCCGGTCTTTATAGTGATTAGTG
GATGTGAGCACATCAGTGGATATTCAGTGCTGGCACAAAAAATCTATCAAAAACATGAAAAATGGCATCC
AGTGTTTTGGGCAACCAATAAATCAGGGACGAATGCATCTGAATATGATTCATCATACATATTATCATCA
TTAAGATCTAATATAATGGCATCAATATGCCATGCGCTTGATGATTCATTAAGTGACAAGGAAAAAAATG
ATATACTGCAGTTTCCTGATAGATTGAAAGGTCTAAAGTATTCACTTGACATATTTATTTCCACATTCTG
TATTGAGAACGTTTTTTTCTCTCAGACGGAAATTGCCGGGATCTGTTTATCTGGTGAACTCATGGGGGAG
AAGGACAAAAACTGTATTTTTGCTGATATCCTTATTTCCGAGATACTGCCACAAATACATGATTCAGACG
TTATTCATGTTAACAAACAAAGAGTGAATGTATCGTTTAAATCAGTTATAGCCATGACTGCATTGTGTTT
TGTTGGATATAGCGGATATTGTTCATATAATGTGTATAACATCAGACATGGTTCTGTTGATACCAGCCAT
GCATTTCTGACAGAGCAGATATCAAAATATGAAGACAAAGTTAGGTCTAACATGCGGTATTTCCCTTTTA
AGCCTGCACTAGATGATAAATATCTATTTTTCAGAGAATCTCTTCATAAAACAACAAGATTCGATATCAG
TCCTGTCTCATGGCGCGTTACTGAATATAAGAAGAATTTCATGCAAGCTTCACCATCAGGAAAGCGAGAA
CTAATTCTGTCGCTCTCATCATCACTTATCAGTTGGGATAAGATGATGAAAGATGAATCCCTGAGTGACT
TAGCAAAATCTCCTGGTATTCATGAGTTACTGAAGATAACCAGACCTCATGATAAAATATCATCAATAGC
TTCACTTGCTGTAGAAAGAGATGAGATACAGAAAAATAATGGAATTGAGAATATTTATGTGTTCAGAAAC
CTCCTGACTGAGTTGGTTCAGAGTGACCCGTCTTATTCATGGTTTGTTTCTGAAGATGTTAATATTCCTG
CTGTAAGAATTACGGACTTTTGGGAAGATGAAAACTCTTCTGTCTATCTTTCCGGAATATGGACACAACC
GGGACAGAATAAACTTCATCAGTGGTATGAGACTATCAAAGAGGCATATGGACGTGATACGGTTCCGGAG
GCGTTCTCATCCTTTGTGCTATACCTGGATGAAAGTCGTCAGGAGCATTTCAGACAGTTTATTATGTCTG
TTGCAAGGGCACGTAAAGACTCACATTCAGGTTTAATGAATCCGCTGCAACTGACCAATATTATACACAA
TCGCTCATCTGAGCATAGATTCTTTCAGTTTGTAGATGATGAATTACACAATATACCAACGAGTTCGGCG
CAGGACTGGCTTTCTGAATTCAGACTGCTTAACCATCTGTTTTCACTTAAAGTGGATAACGGAATGAAAC
GTCAAATAGAACAATTTGATCTCATGTTACGTATATACCTGATTTCTGTTCTTAATAACAGTCAAATGAA
CAGGACACTGACTCATGTTACCACATGGAGAAGCTGGCAGAATGCTCTACGTAATGCCGTGAATTCAGTG
TTACATACAGCATCATCAGTTGAACTTATTCGTAATGCCATGCGTTCAGATCCAGAAAACAAGCTGGTAA
TATTATTTGATGAGTTTGAAAAGGTTCGCTCAGTCATTAACAGCAATAATAGAGAGCCGGTGATTGATTC
TGTATGGGATATTTATGAGCGGCAGATTTATCAACTTCTCGACCATGCTGTCACTTATACAGGGTGTTGG
GTTGGTGAACAATGGAGGAATTCTGTTTTAGGCCGGTTTAACTCAGGAAAACATAATCTCAGTTATTCTG
AGATGCAGGGAAAAGTATATAAGGACATTATTGGCTTTTTGAAAGGTCCGTCTAACGGAGTTTTAGCGCT
TGATCCAGACGGTGTCAGACTGTTGTCCTTCAGGGAAAGAAGTATACCTTTTTCCCCTTCATTCATTACT
TTCATTAATGACATTGTTTCCCCGGATGATCTGCTTGATGTTTGGCTCAGAGAGCGAACGCAAAACAAGG
ATGAATTAATAAATGTACAGGGGCAACTAGACTTACTGAATCAGACCCTACAAAATGCTGAGTCACAGCC
TTACAGAGTTACGATAGATAGTGCACCTGCGACAATTCCGGATAATCCCCGAGTCAAACCAACAGGTACA
ACTCTGACTCTTGAGTGTAAAACAGGTAACAGCAGTATACGAAGTATGAATTTTGCTGATTCAGGTATTT
TTACCTGGTATCCGGGAAGCTGTCACTCTGTAAGAATTGACATTTTGTTCCCTAATTTTTCTGCCACCTA
TAAGTTTACAGGAGAAACAGCCTGGATTGATTTTATCAACAAGTTTTCGGATGGAGAGAGTGAGTTAATG
ACAAAGGATTTTTCTCCAGAATCAAGAAATTTTCTCGAATCAATGGGGATTAAAGGCATTCTTGTCCGTT
ACAAACTGAGTGATACAGGCAATCTAAGTCAGGCATATATCGAATGGGAACAACTAAAACAGGAAAAGGA
TAAACTTAAAGATTTACAGGTGAATCTGAGTAATAAGCTGCTTACCACACATAGCTGGGAGAAAAGTGCC
TGGATTTCCAGACTGCCCGGCAATATAACAATATGTCCAGTAGTACAGGAGTGA
 Primer design