SecReT6
Protein ID: 387615561
SecReT6 ID627
T6SS typei1
Gene symbol-
Locus tagNRG857_01090
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]244605..248129 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDE4P4Z2
KEGG IDeln:NRG857_01090
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-82, Aligned region: 506..819
ImcF-related_N [PF14331], Evalue: 9.10E-60, Aligned region: 209..456
ImcF-related_N [PF14331], Evalue: 9.10E-60, Aligned region: 817..884
DUF1215 [PF06744], Evalue: 1.70E-32, Aligned region: 304..322
DUF1215 [PF06744], Evalue: 1.70E-32, Aligned region: 915..1033
Protein Sequence: 1174 a.a.     [Download]
>gi|387615561|ref|YP_006118583.1| IcmF-like protein [Escherichia coli O83:H1 str. NRG 857C]
MFKFPTSRLFSTLKSALRPAMPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAV
WGLIALVWLTWRVMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYM
VIGPAGSGKSTLLREGFPSDIVYTPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRLREHW
LGWLMQTRARQPLNGLILTLDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGF
AALFHSLDKKDRDAILGVTFTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFSR
QMQGTGEIVTALLAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTPY
FTRRLFPEVLLAEPNLAGENSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKAF
MDVPLPQGTDEFGNLQLPLLNPVRDATLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPSL
MNGLIRDLNIAPPESEEKLAVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYALE
HTDWHAQRQSSDSDAVSRWTPYNKPVINAQHELSKLPIYQRVYQTLRTKALSVLPADLNLRDQIGPTFDN
VFVAGNDEKLVIPQFLTRYGLQSYFIKQHDGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYLSD
YTATWRAGMDNLNVRDYETMPALTDALEQIISGDQPFLRALTALRDNTHALTLSGKLDDKAKEAAINEMD
YRLLSRLGHEFAPENSALEEQKDKASTLQAVYQQLTELHRYLLAIQNSPVSGKSALKAVQLRLDQNSSDP
IFATRQMAKTLPAPLNRWVGKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPHATQDASL
DSFERFFKPDGILDNFYKNNLRLFLENDLTFGDDGRMLIREDIRQQLDTAQKIRNIFFSQQNGLGAQFAV
ETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESQLTLIGTSGRAPRSIAFSGPWAQFR
LFGAGQLTNVTSDTFNVRFNVDGGAMVYRVHVDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|387615344|ref|NC_017634.1|:c248129-244605 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
GTGTTCAAATTTCCCACATCCCGACTGTTCAGCACGTTGAAATCTGCGCTCAGGCCAGCGATGCCGCGGT
TTAAAGTTTCTGCCACCTGGCTACTGACGCTGGCATGGATTTTTCTGCTGGTGTGGATCTGGTGGCAGGG
TCCAAAATGGACGCTCTATGAGCAGCACTGGTTGGCTCCGCTGGCAAACCGCTGGCTGGCGACCGCCGTC
TGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGGGTGATGAAGCGTCTGCAAAAGCTGGAAAAACAGC
AGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGACCGTGGAACTCCACCGCCAGCAGCAATATCTGGA
TCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAACCGCCGTTATCTGTGGCAGTTGCCGTGGTATATG
GTCATTGGTCCTGCGGGTAGCGGCAAAAGCACGCTGCTGCGCGAGGGCTTTCCGTCTGACATTGTTTACA
CGCCGGAAAGCATCCGGGGTGTGGAATACCACCCGCTGATCACACCGCGAGTGGGCAACCAGGCGGTAAT
TTTCGATGTTGACGGCGTACTGACCACTCCCGGCGGGGATGATCTGCTCCGCCGCCTGCGCGAACACTGG
CTGGGCTGGCTGATGCAAACGCGCGCTCGCCAGCCGCTCAACGGTCTTATCCTGACGCTCGATCTTCCCG
ATCTGCTGACGGCGGATAAATCCCGCCGTGAGACACTGGTACAAAATTTGCGCCAGCAACTTCAGGAGAT
CCGTCAGAGCCTGCACTGCCGTCTGCCCGTTTACGTGGTGCTGACACGGCTGGATCTGCTGAACGGCTTT
GCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGCGATGCGATCCTCGGCGTCACATTTACCCGCCGCG
CCCATGAAAGTGACGGCTGGCGCAGCGAACTGGGGGCTTTCTGGCAGACGTGGGTACAACAGGTGAACCT
GGCGCTGTCGGATCTGGTGCTCGCACAAACCGGTGCTGCTCCCCGCAGCGCTGTGTTCAGCTTCTCCCGT
CAGATGCAGGGAACAGGAGAAATCGTCACCGCACTGCTCGCCGCATTGCTGGACGGTGAGAACATGGATG
TAATGCTGCGTGGCGTCTGGCTCACATCCTCGCTACAGCGTGGCCAGGTGGATGATATTTTCACGCAGTC
CGCCGCCCGCCAGTACGGACTGGGTAACAGCTCGCTGGCAACCTGGCCTCTGGTGGAGACGACGCCGTAT
TTTACTCGCCGCCTCTTCCCGGAAGTCCTGCTGGCTGAGCCGAACCTGGCGGGTGAAAACAGCGTCTGGC
TGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCACCTGTGGCGCGGCACTGGCGGCATTGATGGTCGG
AAGCTGGCACCATTATTACAATCAGAACTGGCAGTCTGGCGTTAACGTACTGGCACAAGCTAAAGCCTTT
ATGGACGTACCACTACCGCAGGGAACGGATGAATTCGGCAATCTGCAATTGCCATTGCTTAACCCGGTAC
GCGATGCCACCCTGGCCTATGGTGATTATCGCGATCACGGTTTTCTGGCGGATATGGGATTGTACCAGGG
CGCCCGCGTAGGGCCGTATGTGGAGCAAACCTACATTCAGCTTCTTGAGCAGCGTTATCTCCCCTCGTTA
ATGAACGGCCTGATCCGGGATCTAAACATTGCCCCGCCAGAGAGCGAAGAAAAGCTCGCTGTGCTGCGCG
TAGTGCGCATGATGGAAGACAAAAGTGGGCGCAACAACGAGGCGGTAAAACAGTACATGGCGCGGCGCTG
GAGCAATGAATTTCACGGCCAGCGCGATATTCAGGCGCAACTGATGGTGCATCTGGACTATGCGCTGGAG
CACACCGACTGGCACGCGCAGCGCCAAAGCAGCGACAGCGATGCTGTAAGCCGCTGGACCCCCTATAATA
AACCGGTCATTAATGCGCAACATGAACTGAGCAAGCTACCCATATACCAGCGTGTCTACCAGACCCTTCG
CACCAAAGCATTAAGCGTGTTACCCGCCGATTTGAATTTGCGCGACCAGATTGGTCCCACCTTCGACAAC
GTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATCCCGCAGTTTCTCACCCGCTATGGCCTGCAAAGCT
ATTTTATCAAACAACACGACGGTCTCGTTGAGTTGACCGCGCTGGATTCGTGGGTGCTGAACCTGACGCA
AAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGATCCAGCGCCATATCACTGAACAGTACCTCAGTGAC
TATACCGCTACATGGCGTGCCGGAATGGATAATCTCAACGTCCGTGACTATGAGACCATGCCGGCGCTGA
CCGACGCGCTGGAGCAGATTATCAGCGGTGATCAGCCATTCCTGCGTGCTCTGACGGCGCTGCGCGATAA
TACACACGCGCTGACGCTCTCCGGCAAACTGGACGATAAGGCGAAGGAAGCGGCGATAAATGAGATGGAT
TACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCGCCGGAAAATAGCGCACTGGAGGAGCAAAAGGACA
AGGCGAGTACTCTACAGGCCGTGTATCAGCAACTGACCGAGCTGCACCGTTACCTGCTGGCGATCCAGAA
CTCGCCAGTGTCTGGGAAATCGGCGCTGAAAGCAGTACAGCTACGGCTGGATCAAAACAGCAGCGATCCA
ATCTTCGCCACCCGTCAGATGGCAAAAACCCTGCCTGCGCCTCTTAACCGCTGGGTAGGTAAGCTGGCGG
ATCAGGCCTGGCATGTAGTGATGGTGGAAGCCGTTCGTTACATGGAAGTGGACTGGCGCGACAATGTAGT
GAAACCCTTCAACGAGCAGCTTGCCGATAACTATCCGTTTAATCCGCACGCCACACAGGATGCCTCACTG
GATTCGTTTGAACGTTTCTTTAAACCGGATGGCATTCTGGACAATTTCTACAAGAACAACCTGCGCCTGT
TCCTTGAAAACGATCTGACCTTTGGCGACGACGGCAGAATGTTAATCCGTGAAGATATCCGGCAGCAACT
GGATACTGCGCAGAAAATCCGCAACATCTTCTTCAGCCAGCAGAACGGGCTGGGCGCACAGTTTGCCGTG
GAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGCGTACTTAACCTGGACGGCCAGTTAGTGGACTACA
GCCAGGGACGCAACTACACCGCCCATCTGGTCTGGCCGAACAACATGCGTGAAGGCAATGAAAGCCAGCT
GACGCTGATTGGCACCAGCGGCAGAGCACCGCGCAGTATCGCGTTCAGCGGACCGTGGGCGCAGTTCCGC
CTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGTGACACCTTTAACGTGCGCTTTAACGTGGACGGCG
GCGCGATGGTTTACCGGGTGCATGTGGATACCGAAGATAACCCGTTCACCGGCGGTCTGTTCAGCCAGTT
CCGTTTACCGGATACGTTGTATTAA
 Primer design