SecReT6
Protein ID: 387618081
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13785
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2900629..2901129 [+]
Producthypothetical protein
NoteTssB
UniProt IDE4P5G3
KEGG IDeln:NRG857_13785
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.90E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|387618081|ref|YP_006121103.1| hypothetical protein NRG857_13785 [Escherichia coli O83:H1 str. NRG 857C]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNFNSVMAEF
SPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2900629-2901129 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGATCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTCAACAGCGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTAATGAACAAAATATCGCGCTTG
AATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATATTCCGCAGCTTCGTGTATTACT
CGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA
 Primer design