SecReT6
Protein ID: 387618082
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13790
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2901188..2902726 [+]
Producthypothetical protein
NoteTssC
UniProt IDE4P5G4
KEGG IDeln:NRG857_13790
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|387618082|ref|YP_006121104.1| hypothetical protein NRG857_13790 [Escherichia coli O83:H1 str. NRG 857C]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFNRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2901188-2902726 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATCGATTTATGGCAAAA
CAGCGAAACGCTGGCCGATGCCTCACCCGATGAGCGCGTGACGGCGGCGATTCACGTTCTGCTTTCCTGT
CTGGCGAAATCAGGCGAGGACGTGGTTAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATCTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAACTGCTGGATATC
AGTAAAGAACATCTGCGGCAGGACTTTGATGATTCTCCGGAAATCATTCAAAGTGGTTTATATCGCCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGTAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGACCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTAACCGCGCAGAATATATTAAATGGAAGTCGTTCCGCGATACGGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGCGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAATACCTGTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCACAGGCAGGTGG
CGCAGTGGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCGAACTCTGCCCAGAAACCGGCGTTGTACGATACCGCTGACGC
CACCGCCAACAGCCGTATCAATGCCCGTCTGCCTTACATCTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATTATTCAGCGCGAGAATATCGGCACCACCAAAGACCGCCGCGTGCTGGAACTGGAGCTGAATACCT
GGATCCGCACGCTGGTGACGGAGATGACCGATCCTGGCGATGAACTTCAGGCTTCGCATCCACTGCGCGA
CGGGAAAGTTATCGTCGAGGACATAGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATCGAAGGGATGGACGTCAACCTTTCTCTGGTTTCCCAGATGCCAAAAGCAAAAGCCTGA
 Primer design