SecReT6
Protein ID: 387618084
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13800
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2904080..2904745 [+]
Producthypothetical protein
NoteTssL
UniProt IDE4P5G6
KEGG IDeln:NRG857_13800
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|387618084|ref|YP_006121106.1| hypothetical protein NRG857_13800 [Escherichia coli O83:H1 str. NRG 857C]
MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVELVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLTLVLAGVWWGLHYWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2904080-2904745 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGAAAAAAGATATGGATATCAATATCGATGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATCGAGCTGTATCGCCACTGTCAGCGGCAGGTGGAACTGGTCCG
CGAACGTCTGAAAGATGCCGGATTCAGTCGGGAGAACGTGGAGCACATAACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTGCTCAGCCGTAGTGGCATGGACGACGGTCAGGCCATCTGGATGAAAAACCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCCGGTGAGCTGCTGTACGAACGGATGAAGCAGGTGCTACAGGA
ACCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTGACGCTCACACTGGTACTGGCCGGTGTCTGGTGGGGGCTACATTACTGGCTGAACGTG
CTGGTGGATGAACTGCTGCCGCAAAGCCTGCGTTAA
 Primer design