SecReT6
Protein ID: 387618085
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13805
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2904758..2906410 [+]
Producthypothetical protein
NoteTagL
UniProt IDE4P5G7, E4P5G7
KEGG IDeln:NRG857_13805
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.60E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|387618085|ref|YP_006121107.1| hypothetical protein NRG857_13805 [Escherichia coli O83:H1 str. NRG 857C]
MRNALKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
TYRQPVVLVCGGLSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTIMPGIHR
DVAVLAGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPERASSPWFICTGGEVQVATSTETTMPAQW
IAQSGVQERSQRLCYLLKAESLMQWLNLNVLTALNGPEAKCPPLAMTVGLVPSLPAVDNNLWQLWITART
GLTPDIADTGTDDALPFPDALLRQLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATANRQLLRQVGDD
LHRFYAVPVEEFITKARHLSVLKDDATMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKME
VTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2904758-2906410 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
GTGAGGAATGCGCTGAAACAGGCCATCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCGGTGT
TTATCAGTCCGTCTGGCGTGCTGAGATGGGCCGGTGCGGCGGCTATCGTTCTGGCGGTTGCTGCGTTGTT
GATTTATCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGAA
ACCTACCGACAGCCGGTAGTGCTGGTCTGTGGCGGTCTGTCGGCGCACCTGTTCACTGACAGCCCGGTCC
GCCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCTGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
GCTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCATCATGCCCGGCATACACCGG
GATGTGGCGGTTCTGGCCGGACGGCTGCGACGGTTCGCCCACAGTATGGCGACGGTGCGTCGTCGGGCAG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCGTTGCCGGAAAGAGCGAGTTCACC
GTGGTTTATCTGTACCGGCGGCGAAGTTCAGGTAGCAACATCCACAGAGACCACCATGCCCGCGCAGTGG
ATTGCACAATCCGGCGTACAGGAGCGCAGTCAGCGACTCTGTTACCTGCTGAAAGCTGAAAGCCTGATGC
AGTGGCTGAATCTTAATGTGCTGACGGCACTGAACGGCCCGGAGGCGAAATGTCCACCACTGGCGATGAC
CGTGGGGCTGGTCCCCTCGTTGCCTGCGGTGGATAACAACCTGTGGCAGTTGTGGATCACCGCCAGAACC
GGCCTGACGCCGGATATCGCGGACACCGGCACAGACGATGCGCTGCCATTCCCGGATGCCCTGTTACGGC
AGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGAGCCTGCGTGACCATGCTGGGCGTCACCACCGT
GGCGGGTATCGCCGCGCTGTGCCTGTCAGCCACGGCAAATCGCCAGTTATTACGGCAGGTCGGTGACGAT
CTGCACCGGTTTTATGCCGTCCCGGTGGAGGAATTTATCACCAAAGCCCGTCACCTGTCGGTGCTGAAAG
ACGATGCGACCATGCTCGATGGGTATTACCGGGAAGGAGAACCACTGCGCCTCGGTCTGGGGTTATACCC
CGGCGAACGCATCCGCCAGCCGGTATTACGCGCCATTCGCGACTGGCGTCCGCCTGAACAAAAAATGGAG
GTGACGGCTTCGCTTCAGGTTCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACGCACTGGTGAACATCCGGGCAAAACCGGGCTGGCT
GATCCTCGTGGCCGGATATACCGATGCCACCGGCGATGAAAAAAGCAATCAGCAGTTATCGCTGCGGCGT
GCCGAAGCGGTGCGCAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGCGAGAGCCAGCCTGCGGCGACCAACGACACGCCACAGGGCCGGGCAGTCAACCGGCGTGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA
 Primer design