SecReT6
Protein ID: 387618088
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13820
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2909799..2912261 [+]
Productputative VGR-like protein
NoteTssI
UniProt IDE4P5H0
KEGG IDeln:NRG857_13820
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-63, Aligned region: 30..347
Phage_GPD [PF05954], Evalue: 3.90E-63, Aligned region: 586..613
DUF2345 [PF10106], Evalue: 5.00E-39, Aligned region: 573..592
DUF2345 [PF10106], Evalue: 5.00E-39, Aligned region: 598..749
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 480..585
T6SS_Vgr [PF13296], Evalue: 3.60E-35, Aligned region: 585..610
Phage_base_V [PF04717], Evalue: 3.40E-14, Aligned region: 392..473
Protein Sequence: 820 a.a.     [Download]
>gi|387618088|ref|YP_006121110.1| putative VGR-like protein [Escherichia coli O83:H1 str. NRG 857C]
MNVQFFDHAHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSSDKAIAPESVLMQDGAFSLTAPPVQ
GMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKSVSTRDYNYREATAEMTTGQHDATGGDNTTYGEAYHYADNFLQQ
GDKEAAESGAFYARIRHERYLNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVLITGVTTSAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKEQRGEGFELRTDLWGAVRAKKGIFISADAQDKAQGQ
VLEMQPALARLSAALVTMESLAASAQQAQALAADVSRQQTLLQQKIEQLQQEVLLGSAPKGVALVSGEDM
QLSASDNLTLTAGKQLDIGVQKDFTLAAGKQLSLYSRAGAKLFSSHNDIDIQAQGGNLTTWSTQDTYISS
GKKLVVTAQDELTLICGGGYIKIKSGNVEIGGPGKLLVKNAGIKKAGSGSMQGVMKSFEPESFDENFIIS
NPASGKPIANQKYEIHMPDGSVIAGITDAMGYSSLVASKASDDLKIILKK
 
Nucleotide Sequence: 2463 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2909799-2912261 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGAACGTACAGTTCTTCGACCACGCACACCACAAGCTCAAAATTCGCGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTTGAAGGCCGCGAGCAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGCAGCGA
TAAAGCCATCGCGCCGGAGTCGGTGCTGATGCAGGATGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCGTCATTACCGGCTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGTATGGCGCTGCTTACCCGCAGCCGCCAGAA
CGCCATCTACCAGAACCAGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTACGGTGAGG
ACGACCTGACGTTTGTTTCACGCCTGCTGTCAGAGGTGGGTATCTGGTTCCGCTTTGCCACCGACGCCCG
GTTGAAAATCGAAGTTATCGAATTTTACGACGACCAGAGCGGCTACGAGCGCGGGCTGACGCTGCCGCTT
CGCCATCCTTCTGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACCGCGTACAGCGTGG
TGGAAAAAAGTGTCTCCACGCGGGACTACAACTACCGTGAAGCCACGGCGGAAATGACCACAGGCCAGCA
TGACGCCACCGGGGGCGATAACACCACTTACGGCGAAGCCTACCACTATGCCGACAACTTCCTGCAACAA
GGCGATAAAGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGTCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAGATAAAAGTTCAGGGCGA
CGACGCGCCTGCGGTGTTCCGCAAGGGCGTGCTGATTACCGGCGTGACGACCAGCGCGGCGCGTGACCGC
AGCTATGAGCTGACGTTCACGGCGATACCGTACTCAGAACGCTACGGCTACCGTCCGGCGCTAATCCCCC
GCCCGGTCATGGCCGGAACGCTCCCGGCGCGGGTCACCAGCACGGTGAAGAACGATATCTATGCCCATAT
CGACAAGGACGGGCGCTACCGAGTCAACCTTGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCACCTGCCGCTGCTGGCGGGAA
CGGAGGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACAGGCCGTATATCGCCGGGGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATTCAGAACTACAAGCGCAACGTGCTGCGTACCCCGGCCAACAACAAA
ATCCGGCTGGATGACGAGCGCGGGAAGGAGCATATCAAGGTCAGTACCGAATATGGCGGCAAGAGCCAGC
TAAACCTCGGCCATCTTGTTGATGCCGGGAAAGAACAGCGTGGCGAAGGCTTTGAACTGCGTACCGATCT
GTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCTGATGCGCAGGATAAGGCGCAGGGTCAG
GTGCTGGAGATGCAGCCAGCTCTGGCTCGCCTTTCTGCAGCGTTGGTGACAATGGAATCTCTGGCTGCCA
GTGCGCAACAGGCTCAGGCACTGGCGGCAGATGTGAGTCGTCAGCAGACGCTGTTGCAGCAAAAAATTGA
GCAGTTACAGCAGGAAGTGCTACTGGGTAGCGCACCTAAGGGCGTGGCGCTTGTCAGCGGTGAGGATATG
CAGTTGTCTGCCAGCGATAATCTGACTCTGACAGCAGGTAAGCAACTGGATATTGGCGTACAGAAAGACT
TTACGCTGGCAGCAGGAAAACAGCTCAGCTTGTATAGCCGTGCGGGAGCAAAGCTCTTTAGCTCACATAA
CGATATTGATATTCAGGCGCAGGGGGGAAATCTGACCACCTGGTCAACACAGGACACCTATATATCGAGT
GGTAAAAAGCTGGTGGTGACAGCGCAGGATGAGTTAACACTGATTTGTGGCGGGGGCTATATCAAAATTA
AAAGTGGCAATGTGGAGATTGGCGGTCCGGGAAAACTATTGGTTAAAAATGCCGGTATTAAGAAAGCAGG
CTCCGGTAGTATGCAGGGCGTGATGAAGTCGTTTGAGCCTGAAAGTTTCGATGAAAATTTCATTATTTCG
AATCCAGCATCAGGTAAGCCGATAGCAAATCAAAAATATGAAATACACATGCCAGATGGGAGTGTTATTG
CCGGGATAACCGATGCAATGGGGTATTCCTCTCTTGTTGCGTCAAAAGCATCTGATGACCTAAAAATTAT
TCTGAAAAAATGA
 Primer design