SecReT6
Protein ID: 387618091
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13835
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2915095..2915355 [+]
Producthypothetical protein
NotePAAR
UniProt IDE4P5H3
KEGG IDeln:NRG857_13835
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.20E-19, Aligned region: 9..79
Protein Sequence: 86 a.a.     [Download]
>gi|387618091|ref|YP_006121113.1| hypothetical protein NRG857_13835 [Escherichia coli O83:H1 str. NRG 857C]
MGKNVVVLNDATSHGGKVSSASSTFDIQGKKAALLNDTVTCPKHGTNPIVECDTSYEEGGRGIVVHGCKS
ACGSVVYASLPDVEIG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2915095-2915355 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGGAAAAAATGTGGTAGTACTCAATGACGCAACTTCTCACGGTGGCAAAGTCTCTTCGGCCTCTTCAA
CCTTTGATATTCAGGGAAAAAAGGCTGCACTGCTGAATGATACCGTCACTTGCCCGAAGCATGGTACTAA
CCCAATTGTGGAGTGTGATACCAGTTATGAGGAGGGTGGACGTGGGATTGTTGTGCATGGCTGTAAAAGC
GCCTGCGGCTCGGTGGTGTATGCCAGTCTGCCGGATGTGGAGATAGGCTGA
 Primer design