SecReT6
Protein ID: 387618093
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13845
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2916795..2920133 [+]
Producthypothetical protein
NoteTssM
UniProt IDE4P650
KEGG IDeln:NRG857_13845
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.10E-66, Aligned region: 396..713
IcmF-related [PF06761], Evalue: 9.10E-66, Aligned region: 776..815
DUF1215 [PF06744], Evalue: 2.50E-34, Aligned region: 430..463
DUF1215 [PF06744], Evalue: 2.50E-34, Aligned region: 835..954
Protein Sequence: 1112 a.a.     [Download]
>gi|387618093|ref|YP_006121115.1| hypothetical protein NRG857_13845 [Escherichia coli O83:H1 str. NRG 857C]
MKRVVRLLGVGLLLLVVLLLILFVLAQTTPLISAQDEHAVWLRLLITAIVICLLSMCIFFLFSFRQNEAS
TISLYAQPTDIKEINTEQPNYASLLTIYLRDRYGPFWRRKVRLLLVTGEPEQAEAIAPGLTGQHWLEGDH
TVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRGLINGGKRLGFQAPLYL
WQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLTDNRHDFLLRLAHTLAERG
IAHWQTVLKPLLAGGAFSSLRLRGLMFSPPLAAVPESAPHAWLPSPVWAGVTGDNARGRTVGFPWLRASL
ITGICMLAIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREGAPWY
QRFGLERNQQLLAAAFPGYAQAANRLVSDVAVDHLQQQLSAFVALPPNSPQRTATGEQRYKQLKALLMTA
HPEKADAAFFSTTLMADGLRYENIPEGVRQNVLPSLLTFWMANLPEHPQWETSPPPELTGAVRKILLRQI
GVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARR
EEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIRWKKEDSLSGILDQLTLMADARQS
PLIALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKEKTPQQSREGDDVPVGPLDKTFAPLLRLLGDKA
GGGDSQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWS
GFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLRDDGRI
NLFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKPARDVM
KTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQVTPVD
SSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 3339 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2916795-2920133 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGAAAAGAGTTGTGCGTCTTTTGGGTGTGGGGTTACTGCTCCTTGTTGTGTTGTTGCTCATTTTGTTTG
TTCTGGCTCAGACCACACCGCTGATATCAGCACAGGATGAGCATGCTGTCTGGCTTCGTCTGTTGATAAC
AGCGATTGTGATCTGTTTGCTAAGTATGTGCATATTTTTCCTCTTTTCTTTCCGGCAGAACGAAGCCTCG
ACGATATCACTATACGCTCAACCGACTGATATAAAGGAAATAAATACGGAGCAGCCGAACTATGCATCAC
TGCTGACGATATATTTACGCGACCGCTACGGTCCGTTCTGGCGGCGTAAAGTCCGCCTGCTGCTGGTGAC
CGGCGAGCCTGAACAGGCAGAAGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAAGGCGACCAC
ACGGTGCTGATATATGGCGGCAGGCCAACAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAAC
TGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCA
ACTCGACAAAGGCTGGCGCGGACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCTCCACTCTATTTG
TGGCAGGTCTGTGACGACGGTGATTATCAGACCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGG
AACGCTGTACCCCGGAACAACTGGCTGTAATGCTGGAAGCACAAACCCTGCCGCTGACGGAACAGGGCAT
GTCGCAGCTACTGACCGATAACCGCCATGATTTTCTGCTGCGTCTGGCTCATACCCTTGCAGAGCGGGGT
ATTGCTCACTGGCAGACCGTCCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCCTGCGCCTGCGCG
GCCTGATGTTCAGCCCGCCGCTTGCCGCCGTGCCGGAGTCCGCACCTCATGCGTGGCTGCCGTCACCGGT
CTGGGCGGGCGTCACCGGCGATAACGCGCGGGGTCGCACTGTAGGCTTTCCGTGGCTACGCGCCTCGCTG
ATAACCGGCATCTGCATGCTGGCGATATGGGGGGCCGGAATGACGACCTCGTTCTTCGCCAACCGCGCGC
TTGTTCAGGAAACCGGTATCCAGACGGCACGTGCGCTTGATACCCGCCTGCCGCTGGCAGAACAACTGGT
GGCGCTGCATACCCTGCAGGGCGAACTGGAACGCCTGCAATACCGTATCCGTGAGGGTGCGCCGTGGTAT
CAGCGTTTTGGCCTTGAACGTAACCAGCAACTGCTCGCTGCCGCTTTTCCCGGCTATGCGCAGGCGGCAA
ACCGGCTGGTGAGCGACGTGGCCGTTGACCATCTGCAACAGCAACTGAGCGCCTTTGTCGCGCTGCCGCC
CAACAGTCCTCAGCGTACCGCCACCGGCGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACCGCT
CACCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCAGACGGCCTGCGCTACGAGAATA
TCCCGGAAGGTGTGCGGCAGAACGTGTTGCCGTCACTGCTGACCTTCTGGATGGCGAACCTGCCGGAACA
CCCGCAGTGGGAAACCTCACCGCCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGATT
GGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGATA
TGACGCTGGCAGACATGACCGGAGATACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGG
GATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCGC
GAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCGGATATCTCGCCGGATACGCTGC
GTAACCGTCTCACCTCTCGCTACTTTACCGACTTCGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCG
CTGGAAAAAGGAAGACTCACTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCG
CCGCTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGGCAGGCAGGGAAAACCGTGGTCTGTCAG
ACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGG
TGACGACGTGCCTGTCGGGCCGCTGGATAAAACCTTCGCGCCGCTGCTGCGGTTGCTGGGCGATAAGGCC
GGAGGCGGCGACAGCCAGCTGAGTCTACAGACCTACCTCACCCGCGTCACCCGCGTGCGTCTCAAACTGC
AACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAGCAACTGGCGCAGACGGTTTTACAGGGCAA
AACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAGGAATGGAGT
GGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTAGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGG
ACAGCCTGAACCGCCAGTGGCAGCGGGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGCCGCTATCC
GTTCAAAGCCTCACAGAACGATGCCTCCCTCCCCCTGCTGGCGCAGTACCTGCGCGATGACGGGCGCATC
AACCTGTTTATTGCAGCCAACCTTTCCGGCGTGCTGAAACGAGAGGGCCGCTACTGGGTGGCTGACGCCA
TGAACACGCAGGGGCTGACGGTCAATCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCCGA
TACCGCCTTTGCCAGCGGTGATGCCGGAATACATTTTGAACTGCGGGCAAAACCGGCCCGTGACGTGATG
AAAACACATCTGGTGATTGACGGGCAGGAGCTGGAATATTTCAACCAGAAAGAACGCTGGCAGCGTTTTA
ACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTAAGCTGGACCAGCACACAGGCGATGGAGCGCAT
ACTGGCGGATTACCGGGGAAGCTGGAGCCTTATTCGTCTGCTGGAACAGGCGCAGGTGACACCGGTCGAC
AGCAGCACCTTTAAAGTGGTGTGGAAAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTGCGGGTTGAAC
AGGGCAAAGGGCCGCTGGCGCTGCTGGAGCTGAAAAACTTCCGCCTGCCGGGACAGGTGTTCCTGACCGG
CAGGAGTATGAAGGATGCGGAAGAATACGGGGAAGACGCCGATGAGTGA
 Primer design