SecReT6
Protein ID: 387618095
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13855
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2921742..2922992 [+]
Producthypothetical protein
NotePAAR
UniProt IDE4P652
KEGG IDeln:NRG857_13855
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 8.70E-12, Aligned region: 9..66
Protein Sequence: 416 a.a.     [Download]
>gi|387618095|ref|YP_006121117.1| hypothetical protein NRG857_13855 [Escherichia coli O83:H1 str. NRG 857C]
MGRGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRMTCGKHPGMFIIVGGVPETDIHGRLMAGSLD
SQSSCPCKARFIASMMDDVYEVETEKTENKSVMPLNPLNNGTGNSSPPAYTSDYPALRNTHNLPDQQVRD
MLANNNHDVMLLTYEEGAEVLQSWGCQDFKRKWVDITQSAPGQLIINYGVNGKDVVTTSIVLARLGDFGI
KATAYVNHKGTELIKLTGYPGIRKILNAPVFAAKNPKIVDVGIGKYGLTNSIVKGARLTFYVAAAYRTID
FILNDETSLAEFIGALATDVGKIAIASAVSWGAGKALLATGFVAGPLVGVVVVGIGAALLLNYLDNKFGL
TDQVVAYIEAAQQEFVEKAREIEEGIWDLGAMWAKHMLIKGKEVLEHEVKEYLKDKLNNVSKWELK
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2921742-2922992 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGGAAGAGGTTATTTTCTGGTCAGGGGCGATAAGACCACCTGCGGCGGCAAAATTATTGAAGGGGCGG
ACGACCATACGATCATGGGAATCCCGCAGGCGCGGGATATGGACAGAATGACCTGTGGCAAGCATCCGGG
GATGTTTATTATCGTCGGCGGCGTGCCGGAAACGGATATTCACGGCAGGCTGATGGCGGGATCGCTGGAC
AGCCAGAGCAGTTGCCCGTGTAAGGCGCGGTTTATTGCGTCGATGATGGATGATGTGTATGAGGTGGAAA
CAGAAAAAACTGAGAACAAGTCTGTTATGCCCTTGAACCCTTTAAACAATGGAACAGGAAATTCATCACC
TCCTGCTTATACCTCTGATTATCCTGCCCTTCGTAATACGCACAATCTGCCAGACCAGCAGGTCAGGGAT
ATGCTAGCGAATAATAATCATGATGTTATGTTACTGACGTATGAAGAGGGCGCTGAAGTTCTGCAATCGT
GGGGTTGTCAGGATTTTAAGCGGAAATGGGTTGACATCACGCAATCTGCACCAGGGCAGTTAATTATTAA
TTATGGCGTAAATGGTAAAGATGTAGTGACAACTTCAATCGTGCTTGCCCGCCTGGGGGATTTTGGTATC
AAAGCAACTGCCTATGTTAATCATAAAGGAACCGAACTGATAAAACTTACAGGATATCCCGGCATTCGGA
AAATACTGAATGCACCGGTGTTTGCAGCTAAAAACCCCAAAATAGTAGATGTTGGAATTGGGAAATATGG
ACTCACAAACTCTATAGTAAAAGGGGCAAGATTAACGTTTTACGTCGCAGCTGCTTATAGAACTATTGAT
TTCATCCTGAATGATGAAACATCGTTGGCTGAGTTTATAGGTGCGTTGGCAACAGATGTTGGTAAAATTG
CGATAGCTTCAGCAGTTAGTTGGGGCGCAGGAAAGGCGTTACTGGCCACTGGGTTTGTTGCTGGACCTTT
GGTTGGGGTAGTGGTTGTGGGGATCGGCGCGGCCCTTCTATTAAACTATCTTGATAATAAATTTGGTTTA
ACTGATCAAGTTGTCGCTTATATTGAAGCGGCTCAGCAAGAATTTGTTGAGAAGGCAAGAGAGATTGAAG
AAGGGATTTGGGATCTGGGAGCCATGTGGGCAAAACACATGCTTATTAAAGGGAAGGAAGTACTGGAACA
TGAAGTGAAGGAGTATTTAAAAGATAAACTAAATAATGTGAGTAAATGGGAATTGAAATAG
 Primer design