SecReT6
Protein ID: 387618097
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13865
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2923808..2925568 [+]
Producthypothetical protein
NoteTssF
UniProt IDE4P654
KEGG IDeln:NRG857_13865
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-186, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|387618097|ref|YP_006121119.1| hypothetical protein NRG857_13865 [Escherichia coli O83:H1 str. NRG 857C]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLKEFQVLSRPIGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQER
RVLDAHFSPMGFDDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLENVIWPERITGFEIDVVLAE
NWPHDLPFNTDNLRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDTDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2923808-2925568 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTTG
CGCAGGCTTACCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAAAGAGTTTCAGGTGCTATCCCGTCC
CATCGGCGAACGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCCCGC
TGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGTAGC
CTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGAACGC
CGTGTGCTGGACGCGCACTTTTCCCCGATGGGTTTTGATGACGATGACCGACTGTGGCCGAAAGGTGAGT
CAGCGTTCAGCGGCTACCAGTTGTTGCTGGAATATTTCACCTTCCGTGAGAAGTTTATGTTTGTGGCGCT
GAACGGGCTGGAGAACGTCATCTGGCCGGAAAGGATAACCGGCTTTGAGATTGACGTGGTGCTGGCGGAA
AACTGGCCTCATGATTTGCCGTTTAATACCGACAATCTCCGCCTGCACTGCGTGCCGGTCATCAACCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCGCTGGAAAACGAATTTCTGCTGCGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCCTGCATGACACCTGGCTGATTCTGGGCGGCGATGCATTTGA
TACTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCAGCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCTCCGACGCAGCCCTGCTATCCCCCTGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGTCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCACTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA
 Primer design