SecReT6
Protein ID: 387618101
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13885
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2927560..2928936 [+]
Producthypothetical protein
NoteTssA
UniProt IDE4P658
KEGG IDeln:NRG857_13885
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 118..127
DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 1.10E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|387618101|ref|YP_006121123.1| hypothetical protein NRG857_13885 [Escherichia coli O83:H1 str. NRG 857C]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLCLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDLLAGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RSVQQNDKDASPPVPSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPLSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2927560-2928936 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCGGATGTGGACTGGCGTCAGGTGGA
AAAACTCTGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATCTACTGGCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAATCAACCGAAAAAGTCAGAGGAAAGTCCACAGCCGGTTTTTGCAACC
AGATCCGTTCAGCAAAACGATAAGGATGCCAGTCCACCCGTTCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCGGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTGTCATGCCGTTGCCGCTGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGCGCAGTGGCGCAAA
CAGCGGGAGCTGAGCGCCCTGTCTGCTGAGGCACTGAATGGCTATGCTCAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAACGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCAACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGTTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA
 Primer design

Protein ID: 387618094
SecReT6 ID628
T6SS typei2
Gene symbol-
Locus tagNRG857_13850
StrainEscherichia coli O83:H1 str. NRG 857C
Repliconchromosome [GenBank: NC_017634] [Browse all T6SS(s) in this replicon]
Location [Strand]2920099..2921736 [+]
Producthypothetical protein
NoteTssA
UniProt IDE4P651
KEGG IDeln:NRG857_13850
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.60E-21, Aligned region: 75..135
Protein Sequence: 545 a.a.     [Download]
>gi|387618094|ref|YP_006121116.1| hypothetical protein NRG857_13850 [Escherichia coli O83:H1 str. NRG 857C]
MRKNTGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDSGYHDDFLRIRDEMNK
LSGADTDLICQLAESLLLTQTKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFAAWPEDQHSPSLMPLINALESRLAQSGGMN
AVVPQNSSSVPAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALAKAGAPWDRWTAV
IRQDLTLLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LEMADSQGVEAALGWIQTRPGITTARQRLLLRLLIARVAEQYGKNEMALLLLEELDIATQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMDALLGTLVAINPVRAAVLCDTQHKE
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|387615344|ref|NC_017634.1|:2920099-2921736 Escherichia coli O83:H1 str. NRG 857C chromosome, complete genome
ATGCGGAAGAATACGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AGATACGCCGGTCGGGGAAGACTCCGGCTACCACGACGATTTTCTGCGTATCCGCGACGAGATGAACAAA
CTTTCCGGCGCGGATACGGACCTCATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGACAAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACT
GGCGCTGCTGACCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCGGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCTGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGACCA
GCATTCCCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCACGTCTGGCGCAGTCGGGTGGGATGAAT
GCGGTGGTGCCGCAAAACAGCAGCAGCGTTCCTGCACCGTCATCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACCTCCGGGCGCGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCAGCACACCGGCTGATGAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGAT
GTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACAGAATCGCGCAACCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGTGTCAGCCATTTCTGGCT
GGACATTCAGTGGTATCTGCATCAGGCGCTGGCCAAGGCGGGCGCACCGTGGGACAGGTGGACAGCCGTT
ATCCGTCAGGACCTGACGTTACTGCTGGAGCGCCTGCCGGGACTGGAAAATCTGGCATGGAACGACGGCA
CACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTACCGACAGACGACGCCACAAACGACGTACTGGCGCTGGAGCCGGAAGCG
CTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CGGCACGACAGCGCCTGTTATTGCGGCTGCTGATCGCACGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTTGAAGAACTGGATATTGCCACACAGGGAATAACGCTGACGCAGTGGGAGCCAGAG
CTGCTGTTTGAGGTAAAAGCCCGACAACTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAG
CCCTGCTGAACCGAAAAATGGATGCCCTGCTGGGTACACTGGTGGCAATCAATCCGGTGCGGGCGGCGGT
ACTGTGTGATACGCAGCATAAGGAGTGA
 Primer design