SecReT6
Protein ID: 387816003
SecReT6 ID564
T6SS typei1
Gene symbol-
Locus tagMARHY3621
StrainMarinobacter hydrocarbonoclasticus ATCC 49840
Repliconchromosome [GenBank: NC_017067] [Browse all T6SS(s) in this replicon]
Location [Strand]3745788..3749381 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDH8W8P1
KEGG IDmhc:MARHY3621
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.80E-97, Aligned region: 512..840
ImcF-related_N [PF14331], Evalue: 3.60E-81, Aligned region: 202..462
DUF1215 [PF06744], Evalue: 2.60E-34, Aligned region: 934..1055
Protein Sequence: 1197 a.a.     [Download]
>gi|387816003|ref|YP_005431498.1| IcmF-like protein [Marinobacter hydrocarbonoclasticus ATCC 49840]
MDTMWRKALLIGRWLLPYIRSAAPVTLALGVIALLVATWWLGPRLEINGDYPLMAWQMRALVTLGVVLLV
VMVWGTVLARRLGKVNKAKAEEQREQEDPILPMERRQQRLLDRQLQALKSNLPGRKGLYRLPWYLVMGLE
DAGKTSLIQRAGQTYTLTNVTRNNRGDRNPFSFDWWIGDNGVLIDPDGELLSQNQGEGATGEIQSRLWNH
FIAWLERSRPQRPLNGVILAVDLARLSAANEQQREAHAILLRTRLRELMEQLGSRLPVYVTFTKMDLMYG
FAPFVRTLSKAEKDKALGFTFRLDGQQDQDQWLEQFAERYADMVDELTERLPDVLANTRDNEERAAAYSF
TRQLAGLKPALEQFLTDLLSADAFSTPALVRGTYFTSVLQEGVPEDAFVSAAARNYQMSDPIQPAQRGGQ
SASLFTKGLFPEIIYPEAGLAGDNRRVVRQRHRRVAVAAVVALAAGAGMTAGWQHYFLQNAEAAAQVENR
VKSYLNDWQPVGYEPDTTGRNLLQPLDELRDATLAFGDYRKEWPLVTDMGLYQGHKVGPEVDKAYLNMLA
YQYLPALMFGVMEEMGQAPDNSTERLEHLRVLRMLYDASGRRTDIVSGYMREYWQARFPGQRDVQNRLYG
HLQYAMAHTDLSDLAANGDPTATMALAPFRSSVEWAQHELGRISTSDRVYRELENEASRDFPTPLELARS
SGPAFSTVFTRLDSYGEPLAEDVPSAEDPLSIPALLTREGLEKWFLRESGSVTELALIDAWVLGRRDDVD
FSKADEAELLASLQTLYAEHYAEAWRTALSRLDIHRFEDLNHGVRILDSLTSGHQPLARLLAQVRENTRL
IPVGEGEAEAARKLLEQSPHYRMLQDIERQFSDLNQLTRKQGEEQSGLEEVMLVVAELHEYMRNIQESPD
TGKAALSAARARMGLQGADPIFTLQRMAGHQPEPLNRILNRLATESWRVVLDSAVAQLERDWYREVYQPF
QQNLARHYPFTQGAGRDAALQDFERFFAPDGILETFYNDNLKLFLEDHPEHVGDARRASLVRRDVVAALD
RARQIRQAFFTRSGTLDVEFALEPLNLSNNKRRSVVNIDGQLVEFSHGPSQSIPLVWPNTLRDTVESRVT
LVPIQVNRSPRSISESGPWALFRLLGKADITGVSSNAVDVKFTVDDGEMRYRLHAASNTNPFTEQLLSGY
RIPRSLY
 
Nucleotide Sequence: 3594 bp     [Download]
>gi|387812450|ref|NC_017067.1|:c3749381-3745788 Marinobacter hydrocarbonoclasticus ATCC 49840, complete genome
ATGGATACCATGTGGAGAAAAGCATTACTCATTGGTCGTTGGCTTCTGCCCTACATCCGCAGCGCCGCCC
CCGTCACCCTGGCTCTGGGGGTGATCGCCCTGCTGGTAGCCACCTGGTGGCTGGGGCCACGCCTGGAAAT
CAACGGCGACTACCCGTTGATGGCCTGGCAGATGCGTGCTCTGGTCACCCTCGGGGTGGTCCTGCTGGTT
GTGATGGTCTGGGGCACCGTGCTGGCCCGTCGCCTGGGTAAAGTGAACAAGGCCAAGGCCGAGGAGCAGC
GGGAGCAGGAAGACCCGATTCTGCCCATGGAGCGTCGCCAACAGCGGCTGCTGGACCGCCAGCTGCAGGC
GTTGAAAAGCAATCTGCCGGGTCGCAAGGGCCTGTACCGTCTGCCCTGGTATCTGGTGATGGGCCTGGAA
GATGCCGGTAAGACCAGCCTGATTCAGCGTGCCGGGCAAACCTATACCCTGACCAACGTCACCCGTAACA
ACCGGGGCGACCGTAACCCGTTCAGTTTTGACTGGTGGATTGGCGACAACGGTGTCCTGATCGACCCCGA
TGGCGAACTGCTGAGCCAGAACCAGGGCGAGGGTGCCACCGGGGAAATTCAGAGCCGGCTATGGAACCAC
TTTATCGCTTGGCTGGAACGCAGCCGGCCCCAGCGGCCGCTCAATGGCGTTATCCTGGCTGTGGATCTTG
CGCGCCTGAGCGCCGCCAACGAACAACAGCGTGAAGCCCACGCCATTCTGCTGCGCACCCGCCTGCGGGA
GCTGATGGAACAGCTTGGGTCCCGGCTGCCGGTGTATGTAACCTTCACCAAGATGGACCTGATGTACGGT
TTTGCGCCGTTTGTCCGTACTCTCAGCAAAGCTGAGAAGGATAAGGCCCTGGGGTTCACCTTCAGGCTGG
ACGGCCAGCAGGATCAGGACCAGTGGCTGGAACAGTTTGCCGAGCGTTACGCCGATATGGTGGATGAGCT
CACCGAACGCCTGCCGGACGTGCTGGCCAACACCCGTGATAACGAAGAACGGGCGGCCGCTTATTCGTTC
ACCCGCCAGTTGGCGGGCCTGAAGCCGGCCCTGGAGCAGTTCCTGACGGATTTGCTGTCGGCGGATGCCT
TCTCCACACCGGCACTGGTACGCGGCACCTACTTCACCTCGGTGTTGCAGGAAGGTGTGCCCGAGGACGC
CTTTGTCTCCGCTGCTGCCCGGAACTACCAGATGTCGGACCCGATTCAGCCGGCCCAGCGTGGTGGCCAG
TCTGCGAGCCTGTTCACCAAGGGGCTGTTCCCCGAAATCATCTATCCGGAGGCGGGCCTGGCCGGGGATA
ACCGGCGGGTGGTGCGCCAGCGTCATCGTCGGGTGGCCGTTGCCGCCGTGGTGGCCCTGGCCGCTGGTGC
GGGCATGACGGCGGGCTGGCAGCATTATTTTCTCCAGAATGCTGAAGCCGCCGCCCAGGTGGAAAATCGG
GTGAAAAGCTATCTGAACGACTGGCAGCCGGTTGGCTACGAGCCGGACACCACCGGCCGTAATCTGCTGC
AACCGCTGGATGAGCTGCGGGATGCCACTCTGGCCTTCGGCGATTACCGCAAGGAGTGGCCGCTGGTGAC
CGATATGGGGCTGTACCAGGGCCACAAGGTGGGCCCGGAAGTGGATAAGGCCTACCTGAACATGTTGGCC
TATCAATACCTGCCTGCGCTGATGTTTGGTGTGATGGAGGAAATGGGCCAGGCCCCGGATAACAGCACTG
AGCGGCTCGAACACCTGCGCGTGCTGCGGATGCTTTACGATGCCAGCGGCCGCCGTACCGACATCGTGTC
CGGTTACATGCGTGAATACTGGCAGGCCCGTTTCCCCGGCCAGCGCGATGTGCAGAATCGCCTGTATGGG
CACCTGCAATACGCCATGGCCCACACCGACCTGTCGGACCTGGCTGCCAACGGCGACCCAACCGCCACTA
TGGCTCTGGCGCCCTTCCGCAGCAGTGTTGAATGGGCACAGCACGAACTTGGTCGTATCAGCACCTCAGA
CCGCGTATACCGCGAGCTGGAGAACGAGGCCAGCCGTGATTTCCCGACCCCTCTGGAACTGGCCCGCAGC
TCCGGCCCGGCGTTCTCGACCGTGTTCACTCGCCTGGACAGTTACGGCGAGCCGCTTGCCGAGGATGTGC
CGTCTGCTGAGGATCCACTCTCGATCCCGGCGTTGTTGACCCGGGAGGGCCTTGAAAAATGGTTCCTGCG
GGAATCCGGATCGGTCACTGAACTGGCCTTGATTGACGCCTGGGTGCTGGGCCGAAGGGATGATGTCGAT
TTCAGCAAGGCCGATGAAGCCGAACTGCTGGCCAGCCTGCAAACGCTGTACGCCGAGCACTATGCCGAGG
CCTGGCGCACAGCGCTGAGCCGGCTGGATATCCATCGGTTTGAGGATCTCAACCACGGCGTTCGTATTCT
CGACAGCCTGACCAGCGGCCATCAGCCACTGGCCCGATTGCTGGCGCAGGTGCGGGAAAACACTCGCCTG
ATTCCGGTAGGTGAAGGCGAAGCGGAAGCCGCACGCAAGTTGCTTGAGCAATCTCCCCATTACCGCATGC
TGCAGGACATAGAGCGCCAGTTCAGCGATCTGAACCAGCTTACCCGCAAGCAGGGTGAGGAGCAGTCTGG
GCTGGAGGAAGTCATGCTGGTGGTGGCGGAGCTGCATGAATACATGCGAAACATCCAGGAATCCCCGGAT
ACCGGCAAAGCCGCCCTCAGTGCCGCTCGTGCCCGCATGGGCCTGCAGGGCGCCGACCCTATCTTCACCC
TGCAGCGCATGGCCGGCCATCAGCCGGAACCCCTGAACCGGATACTGAACCGCCTGGCCACCGAAAGCTG
GCGGGTGGTTCTGGACAGTGCGGTGGCCCAGTTGGAGCGTGACTGGTATCGCGAGGTTTACCAGCCTTTC
CAGCAGAACCTGGCCCGGCATTATCCGTTTACCCAGGGGGCAGGGCGTGATGCCGCGCTGCAGGACTTCG
AGCGCTTCTTCGCGCCGGACGGTATTCTGGAGACTTTCTACAACGACAACCTGAAGCTGTTCCTGGAAGA
CCATCCGGAACATGTGGGTGATGCCCGCCGGGCCAGCCTGGTGCGCCGGGACGTGGTTGCTGCGCTGGAC
CGTGCCCGGCAGATTCGCCAGGCGTTCTTTACCCGCAGCGGTACGCTGGATGTGGAATTCGCGCTGGAAC
CCCTGAACCTCAGCAACAACAAACGTCGCTCGGTGGTGAACATCGATGGCCAGCTGGTGGAGTTCTCCCA
TGGTCCCAGCCAGAGCATTCCGCTGGTATGGCCGAACACCCTGCGGGACACCGTGGAGAGTCGGGTAACG
CTGGTGCCGATCCAGGTTAACCGCTCGCCCCGGAGCATTTCCGAGAGCGGTCCCTGGGCACTGTTCCGGT
TGTTGGGTAAGGCGGACATCACCGGTGTCAGCAGCAATGCGGTGGACGTGAAGTTCACGGTGGATGACGG
GGAAATGCGTTATCGCCTGCACGCGGCCAGCAATACCAACCCGTTCACAGAGCAATTGCTCTCAGGGTAC
CGCATACCCCGCAGCTTGTATTAA
 Primer design