SecReT6
Protein ID: 387830672
SecReT6 ID490
T6SS typei2
Gene symbol-
Locus tagECSF_2619
StrainEscherichia coli SE15
Repliconchromosome [GenBank: NC_013654] [Browse all T6SS(s) in this replicon]
Location [Strand]2853517..2856906 [+]
Producthypothetical protein
NoteTssM
UniProt IDD2NLY5
KEGG IDese:ECSF_2619
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.90E-66, Aligned region: 412..730
IcmF-related [PF06761], Evalue: 1.90E-66, Aligned region: 789..835
DUF1215 [PF06744], Evalue: 1.40E-35, Aligned region: 446..479
DUF1215 [PF06744], Evalue: 1.40E-35, Aligned region: 852..971
Protein Sequence: 1129 a.a.     [Download]
>gi|387830672|ref|YP_003350609.1| hypothetical protein ECSF_2619 [Escherichia coli SE15]
MVPGLNRLRPRSVSGPAIVMTVAVVVALCTFIHRKPALLGVEPGSSQQMYWMAGVIAAGVVFLIIMGVYH
LLNRHAAVQNFELRRQLAAGDDYRAVTTKKADSRHPAMVELAAFLRDRYGPFWRRKIRLLLVTGEPEQAE
AIAPGLTGQHWLEGDHTVLIYGGRPSAEPDVALLTALKKLRRSRPLDGIIWPLTEEQSRQTAQLDKGWRE
LINGGKRLGFQAPFYLWQVCDNGDYQSGRVLQSVGCLLPEGCTPEQLAAMLEAQTLPLTEQGMSQLLTDN
RHDFLLRLAHTLAERGITHWQTVLKPLLAGGAFSSLRLRGLMFSPPLAAVPEAAPHAWLPSPVWAGITGD
NARGRAVGFPWLRTALMSAVCVLAIGGAGMTTSFFANRALVQETSIQTARALDTRLPLAEQLVALHTLQG
ELERLQYRIREGAPWYQRFGPERNQQLLAAAFPGYAQAANRLVRDVAVDHLQQQLNAFVALPPNSPQRTA
TGEQRYKQLKALLMTSRPEKADAAFFSTTLMADGLRYENIPEGVRQSVLPSLLTFWMANLPEHPQWKTSP
PPELTGAVRKILLRQIGVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAW
EGQVREAIEQVVTARREEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIRWKKEDSL
SGILDQLTLMADARQSPLIALTDTIAWQVATGRENRGLSDSLAKSAQELFNGKEKTPQQSREGDVPAGPL
DKTFAPLLRLLGDKSGGGGGDTQLNLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTD
TRDYGRLIAASLGEEWSGFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQN
DASLPLLAQYLRDDGRINQFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASG
DAGIHFELRAKPARDVMKTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRG
SWSLIRLLERAQVTPVDSSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDA
EEYGEDADE
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|387828053|ref|NC_013654.1|:2853517-2856906 Escherichia coli SE15, complete genome
GTGGTTCCGGGATTAAACCGTCTCCGGCCCCGTTCGGTTTCAGGGCCTGCCATCGTCATGACCGTGGCTG
TTGTGGTTGCGCTTTGCACGTTTATTCACCGTAAACCGGCATTGCTGGGCGTTGAACCGGGTAGCTCACA
GCAAATGTACTGGATGGCTGGCGTGATTGCCGCAGGCGTGGTCTTTCTGATTATCATGGGGGTTTATCAT
CTGCTGAACCGCCACGCTGCCGTGCAGAACTTTGAACTCCGCAGACAGCTTGCCGCCGGAGATGACTATC
GTGCGGTGACGACAAAGAAAGCCGACAGCCGTCATCCGGCAATGGTGGAACTCGCCGCCTTCCTGCGCGA
CCGCTACGGCCCATTCTGGCGGCGTAAAATCCGCCTGCTGCTGGTGACCGGCGAGCCTGAACAGGCAGAG
GCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAGGGCGACCACACGGTGCTGATATACGGCGGCA
GGCCATCAGCGGAGCCTGATGTCGCGCTACTGACCGCCTTAAAAAAACTGCGCCGCAGCCGTCCGCTGGA
CGGCATCATCTGGCCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCAACTCGACAAAGGCTGGCGCGAA
CTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCCCCATTCTATTTGTGGCAGGTCTGTGACAACGGTG
ATTATCAGTCCGGGCGCGTCCTGCAAAGCGTCGGCTGCCTGCTGCCGGAAGGCTGTACCCCGGAACAACT
GGCTGCAATGCTGGAAGCACAGACCCTACCGCTGACGGAACAGGGCATGTCGCAGCTGCTGACCGATAAC
CGCCATGATTTTCTGCTGCGTCTGGCCCATACCCTTGCAGAGCGGGGTATCACCCACTGGCAGACCGTCC
TGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCCTGCGCCTGCGCGGCCTGATGTTCAGCCCGCCGCT
TGCCGCCGTACCGGAGGCCGCACCTCATGCGTGGCTGCCGTCGCCGGTCTGGGCAGGCATCACCGGCGAT
AACGCGCGGGGCCGCGCGGTGGGCTTTCCGTGGCTGCGTACCGCACTGATGTCCGCTGTCTGCGTGCTGG
CGATAGGGGGGGCCGGAATGACGACCTCGTTCTTCGCCAACCGCGCACTTGTTCAGGAAACCAGCATCCA
GACGGCGCGGGCGCTCGATACCCGCCTGCCGCTGGCAGAACAACTGGTGGCGCTGCATACCCTGCAGGGC
GAACTGGAACGCCTGCAATACCGTATCCGCGAAGGTGCGCCGTGGTATCAGCGTTTTGGCCCTGAACGTA
ACCAGCAACTGCTCGCCGCCGCCTTTCCCGGCTATGCGCAGGCGGCAAACCGGCTGGTGCGCGACGTGGC
CGTTGACCATCTGCAACAGCAACTGAACGCCTTTGTCGCCCTGCCGCCCAACAGTCCTCAGCGTACCGCC
ACCGGTGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACTTCCCGCCCGGAAAAGGCCGACGCTG
CCTTTTTCAGTACCACGCTGATGGCAGACGGCCTGCGCTATGAAAATATCCCGGAAGGCGTGCGGCAGAG
CGTGTTGCCGTCACTGCTGACCTTCTGGATGGCGAACCTGCCGGAACACCCGCAGTGGAAAACCTCACCG
CCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGATTGGTGTGCGTAATGCCGAAAACA
CCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGATATGACGCTGGCGGACATGACCGG
GGATACCCTCACTGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGGGATGTTCACCCGTCAGGCATGG
GAAGGACAGGTCAGGGAAGCTATCGAGCAGGTGGTGACGGCGCGGCGCGAGGAAATCGACTGGGTACTCA
GCGACCGCCAGCAGGATACCTCTGCTGATATCTCGCCGGATACGCTGCGTAACCGCCTCACCTCACGCTA
CTTTACCGACTTTGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCGCTGGAAAAAGGAAGACTCGCTC
TCCGGCATTCTCGACCAGCTGACGCTGATGGCCGATGCCCGTCAGTCGCCACTGATTGCACTGACAGACA
CTATTGCGTGGCAGGTGGCAACAGGCAGGGAAAATCGTGGCCTGTCAGACTCGCTGGCGAAATCGGCACA
GGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGGCGACGTGCCTGCCGGGCCGCTG
GATAAAACCTTCGCGCCGCTGCTGCGGTTGCTGGGCGATAAGTCAGGAGGCGGTGGTGGTGATACGCAAC
TCAACCTGCAAACGTATCTGACCCGCGTCACCCGCGTACGCCTCAAACTGCAACAGGTGACCAACGCCCC
CGACCCGCAGGAGATGACCCAGCAACTGGCGCAGACGGTTTTACAGGGCAAAACCGTTGACCTCACCGAC
ACCCGCGACTACGGGCGGTTAATCGCCGCCAGTCTGGGCGAAGAATGGAGTGGCTTCGGTCAGGCGCTGT
TCGTCCGCCCGGTGGAACAGTCGTGGCGGCAGGTGCTGACGCCCGCAGCGGACAGCCTGAACCGCCAGTG
GCAACGGGCGATTGTCAGTCACTGGAATCAGGACTTCGCTGGCCGCTATCCGTTCAAAGCCTCACAGAAC
GATGCCTCTCTTCCCTTGCTGGCGCAGTACCTGCGCGATGACGGACGCATCAACCAGTTTATCGCCGCCA
ACCTTTCCGGTGTTCTGAAACGTGAAGGCCGCTACTGGGTGGCTGACGCCATGAACACGCAGGGGCTGAC
GGTCAACCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGATGTGGCCGATACCGCCTTTGCCAGCGGC
GATGCCGGAATACATTTCGAACTGCGGGCAAAACCGGCGCGTGACGTGATGAAAACGCATCTGGTGATTG
ACGGGCAGGAACTGGAGTATTTCAACCAGAAAGAACGCTGGCAGCGTTTTAACTGGCCGGATGAACAGTG
GCAACCCGGCGCATCGCTGAGCTGGACCAGCACACAGGCGATGGAACGCATACTGGCGGATTACCGGGGA
AGCTGGAGCCTTATTCGCCTGCTGGAACGGGCGCAGGTAACACCGGTCGACAGCAGCACCTTTAAAGTGG
TGTGGAAAGCGCAGGACGGCCTGCCACTGAATTACCTGCTGCGGGTTGAACAGGGTAAAGGGCCGCTGGC
GCTGCTGGAACTGAAAAACTTCCGCCTGCCGGGACAGGTATTTCTGACCGGCAGGAGTATGAAGGATGCG
GAAGAGTATGGGGAAGACGCCGATGAGTGA
 Primer design