SecReT6
Protein ID: 387868341
SecReT6 ID597
T6SS typei4b
Gene symbolevpO
Locus tagETAF_2213
StrainEdwardsiella tarda FL6-60
Repliconchromosome [GenBank: NC_017309] [Browse all T6SS(s) in this replicon]
Location [Strand]2522299..2526090 [+]
Producttype VI secretion system protein EvpO
NoteTssM
UniProt IDE0T3Y2
KEGG IDetd:ETAF_2213
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-52, Aligned region: 172..426
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 941..991
DUF1215 [PF06744], Evalue: 0.0016, Aligned region: 1009..1025
Protein Sequence: 1263 a.a.     [Download]
>gi|387868341|ref|YP_005699810.1| type VI secretion system protein EvpO [Edwardsiella tarda FL6-60]
MAAMKRLFKWIAIVVLLSVLAMLCWLLTLWQRWPAAAAWVLFLAILAGALLTRYLWRKVRAWRTRSLEAE
PVEKARAAERHPMTLQRQWKAATTLLKHSQLRRFRHPLQVLPWFMLLGRPGSGKSALLAQSGLAAPLDLP
HELNDGKAPVDWWYFDKAVILDISGQFVQPEASQETRSTWNRMLDLLGRDRARAGLNGLVLTVSAQTLLS
ADGGGVVDEGRLIRTRIEQLIRLFDRRFPVYVLVTQIDSLYGMEAWSHLLTPEALDQAMGHVVDEPENGR
DVRDVIDIALGRVNSRLKTMQLTMLLQHPDADPALLMFPTELARLAEPLKRYVYHALGDSPYLESPILRG
VFFASAVQKGNTRSGPEDQQEIALQEAAHDTVKRGVFVRDLFNRVLPADRHLNRPVAVTSPWRRLNRHLG
LFAWWLCVAAALGYLGVSVVYWQHTLDDLRQRYPATMAMNRALPHDMQMMIAQRDAIYWLENRNAQWASR
VLAFQHQLLSVEADAKSQYVNDFSQYILPSLDKAIQQSTTADSIASHPDGLVNAIQVEVRRANLLRARLR
GSSYGALMAMPPIPTPPLRLLYPALDSDTVSRFNDLFLAQLAWSTDIQQQNARLLHLQARLRQLAAQSAT
LDWIIPWANAQPDLTSVTLDDFWQGSLRPDKLPEVDAAYTLEGQQRIRAFLVEMRSSMPNDIAFDKKRAA
FWHEYAQKRLQAWQDFAGQFSQGERILAGQGEWQSTIDRLPHDDNPYLRLARRLLTEFAEMPDDLRPGWL
RVLPQWLEIRQRAHQQALVRVPGLVSDVGGMILRGTAQKGALDQTRSQLVGRLDAIRLYQEYQAAMTQAM
NSVVISQAQATKVAADFHGFDSQQSGQSSLQTAYARLMSLRSLLGYNRPDEQLTWGLMAGPLQLVIRYAD
QQASCFLQSAWQDRVIAPSRWTLNQAERADKLYGDNGLLWTFLSGPIKPFIQRNDSGWQEVDTLGQSVPF
TADFLPFINRALIRQVDLKAGKIALHQKQQQATLAQQQQKQRWQTVAAESGEKLAELNTAAAALKAKSYP
VALTGLPTDVNSNAKAKVVGTLLTMQCTNATLRLNNLNFAVMQSVLWSQQQCGQVTLQIRLPAFTLTRSY
PGPQGFVHFLRDFPGGARRFTPADFPVDKSRMAAVGLTQITVRYRIAGQETLLQDAAQLAQAERDIQSAQ
TRQQQAQQALLTLNRPSASESLPPLDTLPGLTMMSVPERIGQCWRGDIRLARENDGIGRLMSELVAKQLS
DKP
 
Nucleotide Sequence: 3792 bp     [Download]
>gi|387866146|ref|NC_017309.1|:2522299-2526090 Edwardsiella tarda FL6-60 chromosome, complete genome
GTGGCTGCCATGAAACGTCTCTTCAAATGGATAGCGATCGTCGTGCTCCTGAGCGTACTGGCGATGCTGT
GCTGGCTGCTCACGCTGTGGCAACGCTGGCCCGCCGCCGCCGCATGGGTGCTGTTTCTCGCCATTCTGGC
CGGCGCCCTGCTGACCCGCTATCTCTGGCGTAAGGTGCGGGCATGGCGTACCCGCAGCCTGGAGGCGGAG
CCGGTTGAAAAAGCCCGAGCCGCGGAGCGCCATCCCATGACGCTACAGCGCCAGTGGAAAGCCGCCACGA
CCCTGCTGAAGCACTCTCAGCTGCGCCGGTTCCGCCACCCGCTGCAGGTTCTGCCCTGGTTTATGCTGCT
GGGCCGCCCGGGATCGGGAAAATCGGCGCTGCTGGCGCAGTCGGGCCTGGCCGCCCCCTTGGATTTGCCC
CATGAGCTCAATGACGGCAAGGCGCCCGTCGACTGGTGGTATTTCGACAAGGCCGTCATTCTGGATATCT
CCGGCCAGTTCGTACAGCCGGAGGCATCACAGGAGACCCGCTCCACCTGGAACCGGATGCTGGATCTGCT
GGGGCGCGATCGCGCCCGGGCCGGATTGAACGGGCTGGTGCTCACGGTATCGGCCCAGACCCTGCTGTCC
GCAGACGGGGGCGGCGTGGTCGACGAGGGACGGCTGATCCGCACTCGCATAGAGCAGCTGATCCGTCTGT
TCGACAGGCGCTTCCCCGTCTACGTGCTGGTGACCCAAATCGACAGCCTGTACGGCATGGAGGCCTGGTC
CCACCTGCTGACCCCGGAGGCGCTGGATCAGGCCATGGGCCATGTGGTGGACGAACCGGAGAACGGCCGC
GACGTCCGCGACGTGATAGATATCGCCTTGGGTCGGGTCAATAGCCGGCTGAAAACCATGCAGCTGACGA
TGCTGCTGCAGCACCCGGATGCCGATCCGGCCTTACTGATGTTCCCCACCGAGCTGGCCAGGCTGGCCGA
GCCCCTCAAGCGCTATGTCTATCATGCCCTGGGAGACAGCCCCTATCTGGAGTCGCCCATCTTGCGCGGC
GTATTCTTCGCCAGCGCGGTCCAGAAGGGAAACACCCGCAGCGGGCCCGAAGATCAGCAGGAGATTGCGC
TGCAGGAGGCGGCGCATGACACCGTCAAACGCGGGGTCTTTGTCCGGGATCTGTTTAACCGCGTCCTGCC
GGCCGACCGTCATCTGAACCGCCCCGTCGCCGTGACCAGTCCCTGGCGGCGCCTGAACCGCCATCTGGGC
CTGTTCGCCTGGTGGCTGTGCGTGGCCGCCGCCCTCGGGTATCTCGGCGTATCGGTCGTATACTGGCAGC
ACACGCTGGACGATCTGCGCCAGCGCTATCCGGCGACCATGGCCATGAATCGCGCCCTGCCCCACGACAT
GCAGATGATGATAGCCCAGCGGGATGCGATTTATTGGCTGGAAAACAGAAACGCGCAGTGGGCCAGCCGG
GTACTGGCATTCCAGCATCAGTTGCTCTCGGTTGAAGCGGATGCAAAATCGCAGTATGTAAATGACTTTA
GCCAATATATTTTACCCAGCCTGGACAAGGCGATTCAGCAGAGCACCACGGCGGACAGCATCGCATCCCA
TCCCGACGGGCTGGTGAACGCCATTCAGGTGGAGGTCCGCCGCGCCAACCTGCTACGGGCGAGGCTGCGA
GGCTCCAGCTACGGAGCGCTGATGGCCATGCCCCCGATACCAACGCCCCCCCTGCGGTTACTGTACCCGG
CGCTGGATTCGGATACGGTATCCCGTTTCAATGACCTGTTCCTGGCCCAGCTGGCCTGGTCAACGGATAT
CCAGCAGCAGAACGCCCGCCTGCTGCACCTGCAGGCGCGGCTCCGGCAGTTGGCGGCGCAAAGCGCCACC
CTGGACTGGATCATTCCCTGGGCAAACGCCCAGCCGGATCTGACCAGCGTGACCCTGGACGACTTCTGGC
AGGGCTCACTGCGGCCGGATAAATTGCCGGAGGTCGATGCGGCCTACACCCTGGAGGGGCAGCAGCGTAT
CCGCGCATTCCTGGTGGAGATGCGCAGCAGCATGCCGAACGACATCGCCTTCGACAAAAAACGGGCCGCC
TTCTGGCATGAATATGCGCAGAAGCGCTTGCAGGCCTGGCAGGACTTCGCCGGACAGTTCTCTCAGGGAG
AGCGGATCCTGGCAGGTCAGGGAGAGTGGCAGAGCACCATTGACAGACTGCCCCACGATGACAACCCGTA
TCTGCGCCTTGCCCGCCGCCTGTTGACCGAGTTTGCCGAGATGCCGGATGACCTGCGCCCGGGCTGGCTC
CGGGTGCTCCCGCAGTGGCTGGAGATACGCCAGCGCGCCCACCAGCAGGCCCTCGTCAGGGTCCCCGGAC
TGGTCAGCGATGTGGGCGGCATGATCCTGCGCGGGACGGCGCAGAAGGGGGCGCTGGATCAGACCCGCAG
CCAGCTCGTCGGCCGGCTGGATGCCATCCGCCTGTATCAGGAGTATCAGGCGGCCATGACCCAGGCCATG
AACAGCGTCGTCATCAGCCAGGCCCAGGCCACCAAAGTGGCGGCGGACTTCCATGGCTTTGACAGCCAGC
AGAGCGGGCAGTCCTCACTGCAGACGGCCTATGCACGCCTGATGAGCCTGCGCAGCCTGCTGGGATACAA
TCGGCCCGATGAACAGCTCACCTGGGGGCTGATGGCGGGCCCCTTGCAGCTGGTCATTCGCTATGCCGAT
CAGCAGGCCTCCTGCTTCCTGCAGAGCGCGTGGCAGGACCGCGTCATCGCGCCATCGCGCTGGACCCTCA
ATCAGGCCGAGCGGGCGGATAAGCTGTACGGTGACAATGGGTTGCTCTGGACCTTTTTATCCGGGCCGAT
TAAGCCGTTTATCCAACGTAACGATAGCGGCTGGCAGGAGGTGGATACGCTGGGGCAGTCCGTCCCCTTT
ACCGCAGACTTTCTGCCATTCATCAACCGGGCCCTTATCCGCCAGGTTGATCTGAAGGCCGGGAAAATCG
CGCTACACCAGAAACAGCAGCAGGCCACCCTGGCCCAGCAGCAGCAAAAGCAGCGCTGGCAAACCGTGGC
CGCCGAGTCTGGCGAAAAGCTGGCCGAGCTGAACACCGCCGCCGCCGCCCTGAAGGCGAAAAGCTATCCC
GTCGCCCTGACGGGGCTGCCGACGGACGTCAACAGCAACGCCAAGGCCAAGGTCGTGGGAACCCTGCTGA
CCATGCAGTGTACCAATGCCACGCTACGGCTAAACAACCTTAACTTTGCCGTGATGCAAAGCGTACTCTG
GTCACAGCAGCAGTGCGGCCAGGTGACGCTGCAGATCCGGCTCCCGGCCTTCACGCTGACGCGCAGCTAT
CCCGGGCCTCAGGGCTTTGTCCACTTTTTACGGGATTTCCCGGGCGGGGCCCGCCGGTTTACCCCGGCGG
ACTTCCCCGTCGACAAAAGTCGGATGGCGGCGGTCGGGCTAACCCAGATTACGGTACGCTACCGCATCGC
CGGACAGGAGACGCTGCTGCAGGACGCCGCTCAGCTGGCGCAGGCCGAGCGCGATATTCAGTCAGCCCAG
ACCCGCCAACAGCAGGCGCAGCAGGCCCTGCTGACGCTGAATAGGCCGAGCGCATCGGAGAGCCTTCCGC
CGCTGGATACGCTGCCGGGGCTGACGATGATGAGTGTGCCGGAGCGCATCGGGCAGTGCTGGCGGGGGGA
TATTCGCCTGGCCAGAGAAAACGACGGCATTGGCCGGCTGATGAGTGAACTGGTCGCGAAACAGTTAAGC
GACAAGCCGTAA
 Primer design