SecReT6
Protein ID: 387870030
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00649
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]715964..719596 [+]
Producthypothetical protein
NoteTssM
UniProt IDD2T457
KEGG IDepr:EPYR_00649
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.00E-103, Aligned region: 208..488
IcmF-related [PF06761], Evalue: 1.20E-84, Aligned region: 330..391
IcmF-related [PF06761], Evalue: 1.20E-84, Aligned region: 536..839
IcmF-related [PF06761], Evalue: 1.20E-84, Aligned region: 857..886
DUF1215 [PF06744], Evalue: 2.60E-31, Aligned region: 952..1076
Protein Sequence: 1210 a.a.     [Download]
>gi|387870030|ref|YP_005801400.1| hypothetical protein EPYR_00649 [Erwinia pyrifoliae DSM 12163]
MLNMLFAVLTHRLLWGFVGITALSFIIWVIGPVFSIADSRPLEPEVNRQISIGLLYLVWALGNLVPRLYN
AWMNRKLMGSLKTTPGEQPDGDNPRLTSEDRVLAERFNEASELLKKAHFTHAAGRRSPFWAQRFSRQYLY
QLPWYVVIGAPGAGKTTALVNSGLQFPLADRFGKSALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQ
QQDAGEWQGFINLLRKYRARQPINGVIVTVSVSDLLTQSAEAAQQQAVALRQRLTELHEQLGIRFPVYVL
VTKADLLKGFRAYFAKFDKAQREQIWGFTFPWERAKMSDFDLQAAFSQEYARLQQRLDAGLPDTLLQESD
GQARAESFLFPQEFAALRPLLAEYLDRVFARSDFETQFSPRGIYFASGTQEGLPFDRVMGELNRALQLPQ
QDAASGQSGSWDQTSKDAPIPGNKGQSFFLTDVLQKVIFPESGLAGSNRWWELRNRALLWSGYIALAAAL
VISALLWFTSYGNNKSYLQQVQARVPEVVRQSSALQGSEQGDLFALLPFLNSLLTLPESSEFDLNSPPIS
RRMGLYRGAEVSDATQALYHRSLKQLLLPQVAQLITGWLRNDNGSDADYSYEALKAYQMLYQPPHYDGKF
LHAWLMLNLQRTLPQNVTQAQLKQLEWHLSQLLENQIQASPYARDDALVKREQALINQMPLSQRVWGRLK
RLLERDESLKAVSLASLGGPQSELVFSRKSGRSIAEGIPGLFTPAGYWQSFDKHIAAVTAALHDDDRWVL
GVQSAGESQQQTDAAVRQLYIGDYIRQWDGLLQDIQLNNSADLAQRINSARLLSGNNSPLRKLVMNLSHY
LVLEKLPTDEKQTGKEKDAEADNSATRTLQALFRSRQNSTAAAAEQAPEQAVANHFAPVIELAQPLEQGG
KTIAFDDFIRQIDDLYRYLTAVQDAANSGMPPPAGDAISHLQASAGRLPGSLQTLFSTLAVGASSDAQRR
ELENVRKRISSEVGGFCRQAIAGRYPLVRSARSEVTPDDLARMFAPGSGLMDSFFRDNLANKVDTTQSAW
RFTPGIDGKSIGGEDILRPFQQAQSIRDAFFANGATTPAFRVTVRTLRMDNDILNLTLDVDGQLLRYSHG
PQAVQLMNWPGSGGTSQVRMQLGLVDGTTSTLVTNGVWALNRFFDRAQLAPGSSSLSRQASFNVDGHRVT
LEFTPNSIRNPFQLSGFSCP
 
Nucleotide Sequence: 3633 bp     [Download]
>gi|387869382|ref|NC_017390.1|:715964-719596 Erwinia pyrifoliae DSM 12163, complete genome
ATGTTGAATATGCTGTTTGCCGTTTTAACCCACCGCCTGCTGTGGGGCTTTGTCGGTATCACCGCGCTGT
CGTTTATTATCTGGGTGATTGGCCCGGTATTTTCGATAGCCGACTCGCGCCCGCTGGAGCCTGAAGTCAA
CCGTCAGATCAGTATCGGCCTGCTCTATCTGGTGTGGGCGCTGGGCAACCTGGTGCCGCGCCTGTACAAC
GCCTGGATGAACCGCAAGCTGATGGGCAGCCTGAAAACCACCCCTGGCGAACAGCCGGACGGTGATAATC
CGCGTCTGACCAGCGAAGACCGGGTGCTGGCTGAACGCTTTAACGAAGCCTCCGAGCTGCTGAAAAAAGC
GCATTTCACCCACGCAGCCGGCCGCCGCTCGCCGTTCTGGGCGCAGCGCTTCAGCCGTCAGTATCTTTAT
CAGCTGCCGTGGTATGTGGTTATCGGCGCGCCGGGAGCCGGGAAAACCACCGCGCTGGTCAACTCCGGGC
TGCAGTTCCCGCTGGCCGACCGCTTTGGCAAATCCGCGCTGCGCGGCATTGGCGGCACGCGCAACTGTGA
CTGGTGGTTTACCAATGAAGCGGTGCTGCTCGATACCGCCGGGCGTTACACCACCCAGGAGAGCCAGCAG
CAGCAGGATGCCGGAGAATGGCAAGGCTTTATCAACCTGCTGCGCAAATACCGCGCTCGCCAGCCGATCA
ACGGCGTGATTGTCACCGTCAGCGTATCCGACCTGTTAACTCAGTCGGCCGAGGCCGCACAGCAGCAAGC
AGTGGCGCTGCGCCAGCGCCTGACCGAACTGCATGAACAGCTGGGCATTCGTTTCCCGGTTTACGTGCTG
GTCACCAAAGCCGACCTGCTGAAAGGCTTCCGCGCCTACTTCGCCAAATTCGACAAGGCCCAGCGCGAAC
AGATCTGGGGTTTCACCTTCCCGTGGGAACGGGCGAAGATGAGCGATTTTGACCTGCAGGCGGCGTTCAG
CCAGGAGTACGCCCGGCTGCAACAGCGGCTGGATGCCGGATTGCCGGATACGCTGCTGCAGGAGAGCGAT
GGCCAGGCGCGCGCCGAAAGTTTTCTCTTTCCGCAAGAATTTGCCGCGCTGCGCCCGCTGCTGGCGGAAT
ACCTGGACAGGGTGTTTGCCCGCTCCGACTTTGAGACCCAGTTTTCACCGCGCGGCATCTATTTTGCCAG
CGGCACCCAGGAAGGGCTGCCGTTTGACCGGGTTATGGGCGAGCTTAACCGCGCCTTACAGCTGCCGCAA
CAGGATGCGGCCAGCGGCCAGAGCGGCAGCTGGGACCAGACCAGTAAAGACGCGCCGATCCCCGGCAACA
AGGGGCAGAGCTTCTTCCTGACGGACGTGCTGCAAAAAGTGATTTTCCCCGAGTCCGGGCTGGCGGGCAG
CAACCGCTGGTGGGAGCTGCGCAACCGGGCGCTGCTGTGGTCGGGCTATATCGCCCTCGCCGCCGCGCTG
GTGATTAGCGCGTTGCTGTGGTTTACCAGCTATGGCAATAACAAAAGCTATCTGCAACAGGTGCAGGCGC
GGGTGCCGGAAGTGGTGCGGCAAAGCAGTGCGCTACAGGGCAGCGAGCAGGGCGATCTGTTTGCGCTGCT
GCCGTTCCTCAACAGCCTGCTGACGCTGCCGGAAAGCAGCGAATTTGACCTGAACTCACCGCCGATAAGC
CGCCGTATGGGGCTGTATCGCGGAGCCGAGGTCAGCGATGCCACCCAGGCGCTGTACCACAGATCGCTGA
AGCAGCTGCTGCTGCCGCAGGTGGCGCAGCTGATTACCGGCTGGCTGCGCAACGATAACGGCAGCGATGC
TGATTACAGCTATGAGGCGCTGAAAGCTTATCAGATGCTGTATCAGCCGCCGCATTATGACGGCAAGTTC
CTGCATGCCTGGCTGATGCTCAACCTGCAGCGCACTCTGCCGCAGAACGTCACTCAGGCGCAGCTGAAGC
AGCTGGAATGGCATCTTAGCCAGCTGCTGGAAAACCAGATCCAGGCTTCTCCCTATGCGCGGGATGACGC
GCTGGTAAAGCGCGAGCAGGCGCTGATTAACCAGATGCCGCTGTCACAGCGCGTCTGGGGGCGGCTCAAG
CGCCTGCTGGAGCGCGATGAAAGCCTGAAAGCGGTGTCGCTGGCCTCTCTTGGCGGCCCGCAAAGCGAGC
TGGTGTTCTCGCGCAAAAGCGGGCGCTCGATTGCAGAGGGCATTCCCGGCCTGTTTACCCCGGCCGGCTA
CTGGCAGAGCTTTGATAAGCATATTGCGGCGGTGACGGCGGCGCTGCATGATGACGACCGCTGGGTGCTG
GGCGTACAGTCAGCCGGGGAGAGCCAGCAGCAAACCGATGCGGCGGTGCGCCAGCTGTATATCGGCGACT
ATATCCGCCAGTGGGATGGCCTGTTACAGGACATTCAGCTGAACAACAGCGCCGATCTTGCCCAGCGCAT
CAATAGCGCCCGGCTGCTTTCCGGTAACAACTCGCCGCTGCGCAAGCTGGTGATGAACCTCAGCCATTAT
CTGGTGCTGGAAAAATTGCCAACGGATGAGAAACAGACGGGCAAAGAGAAGGACGCAGAAGCCGATAACA
GCGCCACCCGTACCCTGCAGGCGCTGTTCCGCTCGCGCCAGAACAGTACGGCGGCGGCGGCAGAGCAGGC
TCCTGAACAGGCGGTGGCCAACCACTTTGCGCCGGTTATCGAACTGGCACAGCCGCTGGAACAGGGCGGT
AAAACCATCGCCTTTGATGACTTTATCCGCCAGATTGATGACCTGTACCGCTATCTGACGGCGGTGCAGG
ATGCCGCCAACAGCGGCATGCCGCCGCCCGCCGGAGATGCCATCAGCCATCTGCAGGCCAGCGCCGGACG
GTTACCCGGTTCGTTGCAAACCCTGTTCTCCACGCTCGCGGTCGGTGCCAGCAGTGACGCGCAGCGCCGC
GAACTGGAAAACGTACGCAAGCGCATCAGCAGCGAAGTGGGCGGCTTCTGCCGCCAGGCGATTGCCGGGC
GCTACCCGCTGGTACGTTCGGCGCGCAGCGAAGTGACGCCGGATGACCTGGCGCGCATGTTTGCCCCCGG
CAGCGGCCTGATGGACAGCTTCTTCCGCGATAACCTCGCCAATAAAGTGGATACCACGCAGTCGGCCTGG
CGTTTTACGCCGGGCATTGACGGCAAGAGCATCGGCGGCGAAGACATTTTGCGCCCGTTCCAGCAGGCGC
AAAGCATCCGTGATGCCTTCTTTGCTAACGGTGCCACCACGCCAGCGTTTCGCGTGACGGTGCGCACGCT
GCGCATGGATAACGATATCCTTAACCTGACGCTGGATGTTGACGGCCAGCTGCTGCGTTATAGCCACGGG
CCGCAGGCGGTACAGTTGATGAACTGGCCGGGCAGTGGCGGCACCAGCCAGGTGCGTATGCAGCTGGGGC
TGGTGGATGGCACCACCTCTACGCTGGTGACTAACGGCGTCTGGGCGCTGAACCGCTTCTTTGACCGTGC
ACAGTTAGCGCCGGGCAGCAGCAGCCTGAGCCGTCAGGCCAGCTTTAACGTTGACGGCCATCGCGTGACG
CTGGAGTTCACTCCGAACAGCATCCGCAATCCGTTTCAGCTTTCCGGGTTCTCATGCCCGTAG
 Primer design