SecReT6
Protein ID: 387888497
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11800
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1215163..1218534 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDI2B6Y0
KEGG IDebt:EBL_c11800
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.00E-74, Aligned region: 414..727
DUF1215 [PF06744], Evalue: 3.50E-34, Aligned region: 848..969
ImcF-related_N [PF14331], Evalue: 0.002, Aligned region: 170..225
Protein Sequence: 1123 a.a.     [Download]
>gi|387888497|ref|YP_006318795.1| IcmF-like protein [Shimwellia blattae DSM 4481 = NBRC 105725]
MKILSTFLLALLLGALSVCLIGGALWFYPEWVKDTFNTGPFSTTGIVIISLLLMLAALIIGWVLETVFMK
NGEKQGKLDVITSGQQAAASQPEAKHTDADTSRFVAEVLVDHLRLRYSRRWKAKVRLLLVQGSESDIEKV
VPGLKRDHWQESDGIVLIHGGLPESVPDDEFLSVLKDVRPQRPLDGVVQVMNAATLPDTARQDILVRVRQ
KADTLLGWQLPVWLWLVREGTWFRDGEGVPPTGVLFGPGATTEEARSALATLSSELQTPGVAALLENSQH
HWLLNLSKALRGTLRRDLVPLLTTLMSGPAPYRLRGVMLSPALPGTETVPHARLSPPVWQALENDSLQVH
ARKIGFHWQKVLRLVVLGLVLLWGAGTLLSLSVNRTQIWLAQDTARVAADTRQPLPDRLRNQLALQQTIA
RLQNREVHGAPWYTRFGLNQDRDTLKLLWPLYARNSQQLMRDALADELHRQLSAFVQLPPASSARTSATR
KTYSLLKGYLMLARPDKADANWLADNMLKTWPHRSSVPDSVWQTQAPKLLGFWAQNLPAHPEWKITPDHE
IVSTVRQILLRQIGQRNAESGLYQEMLGRIARNWPDLTLADITGDTDASSLFSSEEVVPGMFTHQAWEEQ
VEDAIDEVVKARRDEIDWVLTDKTHQPGGDVSPEMLKQRLTERYFTDFGNAWLNMANSIQWHEAASLSEA
IAQLNLLADVRQSPLVALMNTLAWQGQTGTKGERLADSLVDSAKKLVGRKKSAKQFIDQAQGPKGPLDGV
FGPLTSLMAGKDGTGSNGNLSFQSWLARVTQVRLKLQQVTSAPDPQAMAQMLAQTVFQGKAIDLTDTRDY
GSLVAASLGQEWNGFGQALFVQPLDLAWRQVLAPAAGSLNARWQSTIVSQWNTAFAGRYPFKATGSDASL
PLLAQFLRRDSGRIAAFIKTNLGGMLHQEGSHWVVDQAASQGMHISPAFLVAINKIADISDIVFAQGDAG
VHFELMARPSRDVARTQLTLDGQKLDYFNQMESWQSFTWPGNTYYPGADLSWRSTSSEMRLYASNQGNWG
FIRLLDKAQITPLDSSRTQLVWITPDGSPLKFIMRSELGDGPLALLELQGFSLPQTIFTVGTVDSTSTLA
GDE
 
Nucleotide Sequence: 3372 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1215163-1218534 Escherichia blattae DSM 4481 chromosome, complete genome
ATGAAAATATTATCCACCTTTCTGCTTGCGCTGCTCCTGGGCGCATTATCTGTCTGCCTTATTGGCGGCG
CACTCTGGTTTTATCCTGAGTGGGTTAAGGACACCTTCAACACAGGCCCGTTCAGCACGACCGGCATAGT
GATCATCAGCCTGCTGCTGATGCTGGCGGCGCTGATTATCGGTTGGGTACTTGAAACCGTATTTATGAAG
AACGGTGAAAAGCAGGGAAAGCTGGATGTGATCACCTCCGGACAGCAGGCTGCTGCATCCCAGCCTGAAG
CAAAGCATACCGACGCAGACACCTCCCGGTTTGTGGCTGAGGTGCTGGTCGATCACCTGCGTCTGCGTTA
CAGCCGCCGCTGGAAAGCCAAAGTCCGTTTGTTACTGGTGCAGGGCAGTGAAAGCGATATCGAAAAAGTG
GTGCCGGGCCTTAAACGTGACCACTGGCAGGAGAGCGACGGGATTGTGCTTATTCACGGCGGCCTGCCGG
AAAGCGTGCCTGATGATGAATTTCTGTCCGTCCTGAAAGACGTGCGCCCACAGCGACCGCTGGATGGCGT
GGTGCAGGTGATGAATGCGGCTACACTGCCGGATACGGCGAGGCAGGATATCCTGGTACGTGTGCGGCAG
AAGGCCGATACGTTGCTGGGCTGGCAGCTGCCGGTCTGGTTGTGGCTTGTCCGGGAAGGCACCTGGTTCC
GTGACGGGGAGGGAGTGCCGCCGACAGGCGTCCTGTTCGGCCCGGGGGCGACAACGGAAGAGGCCCGCTC
GGCACTGGCCACGCTCTCGTCGGAGCTGCAAACTCCCGGTGTGGCGGCACTGCTGGAGAATTCACAACAT
CACTGGCTGTTGAACCTGTCAAAAGCCCTGCGCGGCACGCTGCGACGCGACCTGGTGCCGCTGCTGACTA
CGCTGATGTCGGGGCCAGCCCCTTACCGACTGCGCGGAGTGATGCTCAGCCCGGCATTGCCGGGAACCGA
AACGGTGCCACATGCGCGCCTGTCGCCACCGGTCTGGCAGGCACTTGAAAATGACAGCCTGCAGGTGCAT
GCCCGTAAAATCGGCTTCCACTGGCAAAAGGTGCTGCGTCTGGTGGTGCTGGGGCTGGTTCTTCTCTGGG
GGGCAGGCACGTTGCTGTCGCTGTCCGTCAACCGCACTCAAATCTGGCTCGCTCAGGATACGGCACGGGT
GGCGGCCGATACCCGGCAGCCTTTGCCGGATCGCCTGCGTAACCAGCTGGCCTTGCAGCAGACCATTGCC
CGCCTGCAGAACCGTGAAGTACACGGTGCGCCGTGGTACACCCGCTTTGGCCTGAACCAGGACAGGGATA
CACTGAAGTTGCTCTGGCCTTTATACGCCCGTAACAGCCAGCAACTGATGCGCGATGCGCTGGCAGATGA
ACTTCACCGCCAGCTCAGCGCCTTTGTTCAGTTGCCTCCGGCAAGCAGCGCACGTACGTCTGCCACCCGG
AAGACGTACAGCCTGCTTAAAGGTTACCTGATGCTGGCCCGTCCCGATAAAGCGGATGCAAACTGGCTTG
CCGATAATATGCTGAAAACCTGGCCGCACCGCAGCAGCGTGCCGGACAGCGTATGGCAGACCCAGGCCCC
GAAGCTGCTCGGCTTCTGGGCGCAGAACTTGCCGGCACACCCGGAGTGGAAAATCACCCCTGACCACGAA
ATAGTGAGCACGGTACGCCAGATTCTGCTCAGGCAGATTGGTCAGCGTAACGCGGAAAGCGGCCTGTATC
AGGAGATGCTCGGGCGTATTGCCCGTAACTGGCCGGATTTAACCCTCGCGGACATAACCGGCGATACGGA
TGCTTCGTCCCTGTTCTCCTCTGAGGAAGTGGTGCCAGGGATGTTCACCCACCAGGCATGGGAAGAGCAG
GTTGAAGATGCGATTGATGAGGTAGTGAAGGCCCGCCGTGATGAAATCGACTGGGTACTCACCGACAAAA
CCCATCAGCCAGGCGGTGATGTCTCACCGGAGATGCTGAAACAGCGCCTGACGGAGCGTTATTTTACTGA
TTTTGGCAACGCCTGGCTCAATATGGCCAACAGCATTCAGTGGCACGAAGCGGCCTCGCTCTCCGAAGCC
ATTGCCCAGCTGAATCTGCTGGCGGATGTTCGTCAGTCACCGCTGGTGGCGCTGATGAATACTCTTGCCT
GGCAGGGACAGACCGGAACTAAAGGAGAGCGACTTGCAGACTCTCTGGTGGACTCGGCGAAAAAACTGGT
CGGGCGTAAGAAGAGCGCTAAGCAGTTTATTGATCAGGCGCAGGGTCCAAAAGGGCCGCTCGACGGCGTG
TTTGGCCCGCTCACGAGCCTGATGGCTGGTAAGGACGGTACCGGCTCGAACGGCAACCTCAGTTTCCAGT
CCTGGCTTGCCCGTGTAACCCAGGTGCGACTCAAACTCCAGCAGGTAACCAGCGCTCCCGATCCCCAGGC
GATGGCGCAGATGCTGGCTCAGACCGTCTTCCAGGGAAAAGCCATCGACCTGACCGACACCCGTGATTAT
GGTTCTCTGGTGGCGGCAAGTCTCGGGCAGGAGTGGAACGGATTCGGGCAGGCGCTGTTTGTGCAGCCGC
TTGACCTGGCCTGGCGTCAGGTGCTGGCCCCGGCCGCAGGCAGCCTTAATGCCCGCTGGCAGAGCACCAT
TGTTTCGCAGTGGAACACCGCCTTTGCCGGACGCTATCCGTTCAAGGCCACCGGCAGCGATGCCTCCCTG
CCGTTACTGGCCCAGTTCCTGCGGCGCGACTCCGGGCGCATTGCGGCGTTCATCAAAACTAACCTCGGCG
GCATGCTGCATCAGGAGGGCAGTCACTGGGTGGTGGATCAGGCCGCCAGCCAGGGAATGCATATCAGCCC
CGCGTTTCTTGTCGCCATTAATAAGATTGCCGATATCTCGGATATCGTCTTTGCTCAGGGCGATGCCGGG
GTACATTTCGAGCTGATGGCCCGGCCATCACGCGATGTGGCCCGTACCCAGCTGACGCTTGATGGACAGA
AACTGGATTACTTCAACCAGATGGAAAGCTGGCAGAGCTTCACCTGGCCGGGCAATACGTATTATCCGGG
AGCCGACCTGAGCTGGCGCTCAACCAGCTCTGAAATGCGTCTCTATGCCAGCAACCAGGGCAACTGGGGC
TTTATTCGACTGCTCGACAAGGCACAGATCACCCCGCTCGACAGCAGCCGCACCCAGCTGGTGTGGATCA
CCCCGGACGGCAGCCCGCTGAAATTTATCATGCGCAGCGAGCTCGGCGACGGGCCGCTGGCGCTGCTCGA
ACTGCAGGGCTTCAGCCTGCCGCAGACGATTTTTACCGTGGGTACAGTTGACAGCACATCCACGCTTGCC
GGAGACGAATAA
 Primer design