SecReT6
Protein ID: 387893599
SecReT6 ID656
T6SS typei1
Gene symbol-
Locus tagPflA506_2413
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2629112..2630641 [+]
Productsigma-54 dependent transcriptional regulator, Fis family
NoteSfa2
UniProt IDI2BKJ9
KEGG IDpfc:PflA506_2413
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 5.20E-70, Aligned region: 197..364
Sigma54_activ_2 [PF14532], Evalue: 5.00E-22, Aligned region: 64..108
Sigma54_activ_2 [PF14532], Evalue: 5.00E-22, Aligned region: 198..368
HTH_8 [PF02954], Evalue: 8.00E-10, Aligned region: 354..361
HTH_8 [PF02954], Evalue: 8.00E-10, Aligned region: 458..498
AAA_5 [PF07728], Evalue: 4.40E-07, Aligned region: 31..61
AAA_5 [PF07728], Evalue: 4.40E-07, Aligned region: 221..339
HTH_30 [PF13556], Evalue: 1.00E-05, Aligned region: 453..464
HTH_30 [PF13556], Evalue: 1.00E-05, Aligned region: 467..498
GAF_3 [PF13492], Evalue: 0.00012, Aligned region: 37..153
GAF_3 [PF13492], Evalue: 0.00012, Aligned region: 203..255
GAF_2 [PF13185], Evalue: 0.003, Aligned region: 39..150
GAF_2 [PF13185], Evalue: 0.003, Aligned region: 267..293
Protein Sequence: 509 a.a.     [Download]
>gi|387893599|ref|YP_006323896.1| sigma-54 dependent transcriptional regulator, Fis family [Pseudomonas fluorescens A506]
MTDNLPGGGADALRYADALSACFARLGFERDEHALPDGCVSTAARLSQSDVSQLYLLDEVTGRLELIAQH
LAQVSSLTVVPPRPGQHSQQLLHDALTQGTGLSLEDVQGSGHDTGFLPALATPWRALLIVPLFNQCERIT
GVLVCARQQPAQLQGYAPSLGHLGSYAVNRLRVLRGRQPNVGPKPAGHKPLVGAYGLIGTSAAMEQACRL
ISKVLHTPYTVLLQGETGTGKEVVARAIHTAGPRKAKAFVVQNCAAFPEGLLESELFGYRKGAFTGADRN
HGGLFDAAHGGTLLLDEIGDMPLPLQAKLLRVLQEGEVRPLGASAAHKVDVRIIAATHRDLAAMVAEGRF
REDLYYRLAQFPITLPALRERDGDVLQLARHFTGKVCAALGRPPVEWANTALDQLSSHGFPGNVRELKCL
VERAVLLCDDSVIRPEHLALPLAPEPATPDDVTLRQRMERVERTFLLDCLHKNHGNRTRTARELGVARRT
LLYRLARLNIPFGDAREER
 
Nucleotide Sequence: 1530 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2629112-2630641 Pseudomonas fluorescens A506 chromosome, complete genome
ATGACCGATAACCTGCCCGGTGGCGGGGCCGACGCGCTGAGGTATGCCGACGCGTTGTCTGCCTGTTTCG
CACGCTTGGGGTTCGAGCGTGATGAACACGCGTTACCTGACGGATGTGTCAGCACGGCGGCCCGGCTGAG
CCAATCTGACGTCAGCCAATTGTATCTGCTCGATGAAGTGACCGGCCGGCTTGAACTGATCGCCCAACAT
CTAGCCCAAGTGTCGTCGCTCACCGTCGTGCCTCCACGGCCTGGTCAGCATTCCCAACAGTTGCTGCACG
ACGCCTTGACCCAAGGCACTGGGTTGAGCCTGGAGGATGTGCAAGGCAGCGGCCATGACACAGGTTTTCT
GCCCGCATTGGCGACACCATGGCGTGCGCTATTAATCGTGCCGCTGTTCAATCAATGTGAGCGGATAACT
GGGGTGCTGGTGTGCGCCCGCCAACAGCCGGCCCAGCTGCAAGGCTACGCCCCCTCGTTGGGGCATTTGG
GCAGCTACGCCGTGAACCGGTTACGCGTACTGCGCGGTAGGCAGCCCAACGTCGGCCCAAAGCCCGCAGG
CCACAAACCCTTGGTTGGCGCATACGGCCTGATTGGCACCAGCGCGGCAATGGAGCAGGCCTGTCGTTTG
ATCAGTAAAGTTCTGCACACCCCTTACACCGTGCTGTTGCAGGGTGAGACCGGCACAGGCAAGGAAGTGG
TGGCCCGGGCCATACACACGGCCGGGCCGCGCAAGGCCAAGGCCTTTGTCGTGCAGAACTGCGCGGCGTT
CCCGGAAGGATTGCTTGAAAGTGAGCTGTTCGGCTACCGCAAAGGTGCGTTCACTGGCGCCGATCGCAAT
CACGGGGGGCTGTTCGACGCCGCACATGGCGGTACGTTGCTGTTGGATGAGATCGGCGATATGCCGCTGC
CCTTGCAAGCCAAGTTGCTGCGGGTATTACAGGAGGGTGAGGTTCGCCCGCTGGGTGCCAGTGCGGCACA
TAAGGTCGACGTACGCATCATTGCCGCGACCCACCGCGACCTCGCGGCGATGGTCGCCGAAGGGCGCTTT
CGCGAAGACCTCTATTACCGACTGGCTCAGTTCCCCATCACCTTACCGGCCCTGCGCGAGCGGGACGGCG
ATGTGCTGCAACTGGCGCGCCATTTCACAGGCAAGGTGTGCGCGGCGCTGGGGAGGCCACCTGTCGAATG
GGCGAATACCGCCCTCGATCAACTGTCCAGCCATGGTTTTCCCGGCAACGTACGCGAGCTCAAATGCCTG
GTGGAACGCGCCGTGTTGTTGTGTGACGACAGCGTGATTCGGCCCGAGCACCTGGCACTGCCGCTGGCAC
CAGAGCCGGCCACTCCCGATGACGTGACGCTGCGCCAGCGGATGGAGCGAGTGGAGCGTACGTTCCTGCT
CGACTGCCTGCACAAGAACCATGGCAATCGCACCCGCACCGCGCGGGAGCTGGGGGTCGCCCGGCGCACC
CTGCTTTACCGTCTTGCCCGTTTGAACATTCCCTTTGGCGATGCCCGGGAGGAACGGTGA
 Primer design