SecReT6
Protein ID: 387893605
SecReT6 ID656
T6SS typei1
Gene symboltssM2
Locus tagPflA506_2419
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2634720..2638085 [+]
Producttype VI secretion protein TssM2
NoteTssM
UniProt IDI2BKP7
KEGG IDpfc:PflA506_2419
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.60E-59, Aligned region: 303..324
IcmF-related [PF06761], Evalue: 1.60E-59, Aligned region: 371..407
IcmF-related [PF06761], Evalue: 1.60E-59, Aligned region: 464..749
ImcF-related_N [PF14331], Evalue: 2.30E-53, Aligned region: 189..374
ImcF-related_N [PF14331], Evalue: 2.30E-53, Aligned region: 376..418
DUF1215 [PF06744], Evalue: 1.10E-34, Aligned region: 285..317
DUF1215 [PF06744], Evalue: 1.10E-34, Aligned region: 376..411
DUF1215 [PF06744], Evalue: 1.10E-34, Aligned region: 855..979
Protein Sequence: 1121 a.a.     [Download]
>gi|387893605|ref|YP_006323902.1| type VI secretion protein TssM2 [Pseudomonas fluorescens A506]
MIAFFKGVGTVLGRIWVWSLLLVLSCAAMVWFLGPLLAVDDHRIWAGATARLVTISGVFLLWGLAMAFVG
PGFAAWRQRPEREVRRQPMTRVEDERRHLRSRFKKAVHLLKISRHYGERNARWRHELPWYLLIGEPGSGK
TQLLAAAGLPLALDHAQTRPIGSSAHCDWYFGDEGVLIDTPGRYLTQPDSSVDAAGWITLLHLLRWRRRV
RPLSGVVVTLSVDMLSSTNEYDLDHHARHVHSRLQEIQQTLHVDVPIYLVLTHADRLPGFAEFFDSPLGE
SADSVLGQHLQGCADGTDTTQVRQAVEQLLQRLNSELIGRLHQERNVERRGQMLEFPQQAARMGERVSLF
VDMAFCAHRYQPINGLRGFFLTCADGRHPRFVQGLFSQVISAEADLAGLQAQEQQRLRWRQGAQAVAAAL
VIGGVGGLWGHSYSVNHQRLAQLSALTSHPPLALAADDESTALLALLDARLAATQVFPGPADVRLVERTG
LYQGELSRPSVDQAYDHALQKPFLAWTAAQLEEQVIASLGDRERLLDDLRAYLMLNLRERRDTTWLAEHI
ASLWSVRFAGDMPTQKRLNVHLARLLEQPFVVSLNAERVAQAREALRGESLADGVYRVLREQARSLEPLR
LAEGKVFAAIDPPVPGFYTKRYVQYFEAQGPRLVNAITQDNWVLGEGTDLGTEDLRRLMAELQQRYFSEY
ADAWSDALGRVSLQETDNLRQDAEQLMNLTSAQSPLIRLLQQVRENTRLLPSHGLLDKVAQQSADLGEMA
KSRLTAGQAGIVEAPRRALQRRFEPLHQLLDEQQNPGVELTQALRLLDEVHLHLTALNRDSAPEQAAFLR
ARQRMEGQQDALGHLRDAAARLPLPVAGWLESMADDSWRHLLEQAYVHVNQRYQSEVHSLYAKAIGRRYP
FNAHASSEVALHDFQEFFKPRGVMARFYEGYLRPFISADGSRYRLRGLDGQSLPVSRALLEQLMKIQVIR
RGFFTEDAGELSVRFTLAPNSLDPSVSRAILRFGDQQLEYRHGPIVPMTFHWPTDADNGRSSLVLERGAE
QRPLGIEKDTGAWSLFRFLDLLQKEPASGRNIQILKADLAGLRANYRLTSQRTPGPFDMDTWRTFRLPEQ
L
 
Nucleotide Sequence: 3366 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2634720-2638085 Pseudomonas fluorescens A506 chromosome, complete genome
ATGATCGCATTCTTCAAGGGGGTGGGCACCGTGCTGGGCAGGATTTGGGTGTGGAGCCTGTTGCTGGTGC
TTTCCTGCGCGGCAATGGTGTGGTTCTTGGGGCCGCTGCTGGCAGTGGATGATCACCGTATCTGGGCCGG
GGCGACTGCTCGGTTGGTCACCATCAGCGGTGTGTTCTTGCTATGGGGACTGGCGATGGCGTTTGTGGGC
CCAGGTTTTGCCGCCTGGCGCCAAAGACCAGAACGCGAGGTGCGCCGACAGCCGATGACGCGGGTGGAGG
ACGAACGCCGGCACCTGCGCAGTCGGTTCAAGAAAGCCGTGCACCTGCTCAAGATATCCCGCCATTATGG
AGAGCGTAACGCGCGTTGGCGTCATGAGTTGCCCTGGTACCTGTTGATCGGTGAGCCGGGCAGTGGCAAG
ACACAGCTGCTGGCGGCAGCGGGCTTGCCGCTGGCGCTGGACCACGCGCAAACGCGGCCGATCGGTAGCA
GTGCCCATTGTGACTGGTATTTCGGCGACGAAGGCGTGCTGATCGACACCCCGGGACGCTACCTTACCCA
GCCCGACTCTTCAGTGGACGCCGCAGGCTGGATCACCTTGCTGCATCTGCTCCGGTGGCGCCGTCGAGTG
CGGCCGCTCAGCGGTGTGGTGGTGACGCTATCGGTCGACATGCTGTCGAGCACCAACGAATACGACCTGG
ATCATCACGCACGCCATGTACACTCGCGCCTGCAAGAGATCCAACAGACGTTGCATGTGGATGTGCCGAT
TTACCTGGTGTTGACCCACGCCGACCGATTGCCGGGATTCGCTGAATTCTTTGACTCACCCCTTGGAGAA
AGTGCCGACAGCGTGTTGGGTCAGCACCTGCAAGGTTGCGCCGACGGTACTGACACAACACAGGTTCGTC
AGGCGGTCGAGCAATTATTGCAGCGCTTGAACAGTGAGCTGATTGGGCGACTGCATCAGGAGCGCAATGT
CGAGCGACGTGGGCAGATGCTGGAGTTTCCCCAGCAGGCAGCACGAATGGGGGAGCGCGTCAGCCTGTTC
GTTGACATGGCGTTTTGCGCACATCGCTACCAACCCATCAACGGTTTGCGAGGGTTCTTCTTGACCTGCG
CCGATGGCAGGCACCCGCGCTTTGTGCAGGGTCTGTTCAGCCAGGTGATCTCCGCCGAGGCCGACCTTGC
GGGTTTGCAGGCTCAGGAACAACAACGTCTGCGTTGGCGCCAGGGCGCGCAGGCGGTGGCTGCAGCGCTG
GTTATTGGCGGTGTCGGCGGGCTATGGGGGCACAGTTACTCAGTCAACCACCAACGCTTGGCGCAATTGT
CGGCGCTGACCTCACACCCGCCGCTCGCCCTTGCGGCCGACGATGAAAGCACGGCGCTGTTGGCGCTGTT
GGACGCGCGACTGGCGGCGACCCAGGTTTTTCCTGGGCCGGCAGATGTACGCCTGGTGGAGCGCACCGGG
CTGTATCAGGGCGAACTGAGCCGTCCCAGCGTCGATCAAGCCTATGATCACGCGCTGCAAAAGCCATTTC
TGGCCTGGACAGCCGCCCAGTTGGAAGAACAGGTAATTGCCAGCCTCGGGGACCGGGAGCGGCTGCTCGA
CGACCTGCGTGCCTACCTGATGCTCAATCTGCGCGAACGCCGTGACACGACCTGGCTGGCAGAACATATT
GCAAGCCTTTGGTCGGTGCGGTTTGCCGGGGATATGCCAACACAGAAGCGCCTCAATGTGCACCTTGCGC
GGCTGCTGGAGCAACCTTTTGTGGTGTCACTCAACGCGGAGCGGGTGGCCCAGGCCCGTGAAGCGCTGAG
GGGCGAATCGTTGGCCGATGGGGTCTATCGGGTATTGCGCGAACAAGCGCGCAGCCTGGAGCCGTTGCGG
CTGGCCGAGGGTAAGGTGTTCGCCGCTATCGATCCGCCTGTGCCGGGGTTCTATACCAAACGCTATGTGC
AGTACTTTGAGGCGCAGGGCCCGCGGTTGGTAAACGCCATCACCCAGGACAACTGGGTGCTCGGCGAGGG
TACCGACCTGGGGACCGAGGACTTGCGGCGCCTGATGGCTGAACTGCAGCAACGTTATTTCAGCGAGTAT
GCCGATGCCTGGAGCGATGCGCTTGGCCGAGTCAGTCTGCAAGAGACTGACAACCTGCGCCAGGATGCCG
AGCAACTGATGAACCTGACGTCGGCGCAATCGCCTTTGATTCGTCTCTTGCAACAGGTGCGTGAAAATAC
GCGTTTGTTGCCAAGCCATGGACTGCTGGACAAAGTGGCCCAGCAGTCGGCAGACCTGGGCGAGATGGCC
AAGTCGAGGTTGACGGCGGGGCAGGCGGGTATTGTCGAGGCTCCGCGGCGCGCCTTGCAGCGCCGCTTTG
AGCCTTTGCATCAATTGCTGGATGAGCAGCAGAACCCCGGCGTAGAGCTGACTCAGGCCTTGCGTCTGCT
GGATGAAGTGCACCTGCATTTGACGGCCTTGAACCGGGACAGCGCACCCGAGCAGGCCGCCTTCCTGCGT
GCCAGGCAGCGCATGGAGGGCCAGCAGGATGCATTGGGCCATCTGCGAGACGCCGCCGCTCGCCTGCCGC
TGCCCGTTGCCGGCTGGCTCGAAAGTATGGCGGATGACAGTTGGCGGCATTTGCTGGAACAGGCCTATGT
GCACGTCAACCAACGTTATCAGAGCGAGGTGCATAGCCTTTATGCCAAGGCCATTGGCCGACGTTACCCA
TTCAATGCGCACGCCAGCAGTGAGGTCGCCCTTCACGATTTTCAGGAGTTCTTCAAGCCACGCGGGGTGA
TGGCGCGCTTTTATGAGGGCTACCTGCGGCCTTTTATCAGTGCCGACGGCAGCCGCTACCGATTGCGTGG
GCTGGATGGCCAGAGTTTGCCGGTTTCCCGTGCGCTGCTGGAGCAATTGATGAAGATCCAGGTCATCCGC
CGCGGCTTTTTTACCGAAGACGCGGGGGAGTTGTCCGTGCGATTCACCTTGGCACCCAACAGCCTGGACC
CATCGGTCAGCCGAGCGATCCTGCGGTTTGGCGACCAGCAATTGGAGTATCGCCACGGTCCGATCGTACC
CATGACGTTCCATTGGCCCACCGACGCAGACAATGGGCGCAGCAGCCTCGTCTTGGAGAGAGGCGCGGAG
CAGCGCCCCTTGGGCATCGAAAAAGACACTGGAGCGTGGTCGTTGTTCCGGTTTCTGGACCTGCTGCAGA
AAGAGCCCGCCAGCGGCCGTAATATACAGATCCTCAAGGCAGACCTCGCCGGCCTGCGCGCCAATTACCG
GCTCACCAGCCAGCGTACGCCCGGTCCGTTTGACATGGACACATGGCGCACCTTTCGCCTGCCGGAGCAG
CTGTGA
 Primer design