SecReT6
Protein ID: 387893606
SecReT6 ID656
T6SS typei1
Gene symbolstp1
Locus tagPflA506_2420
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2638082..2638813 [+]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDI2BXN9
KEGG IDpfc:PflA506_2420
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 4.50E-18, Aligned region: 21..206
PP2C [PF00481], Evalue: 2.80E-13, Aligned region: 26..229
SpoIIE [PF07228], Evalue: 9.60E-10, Aligned region: 37..242
Protein Sequence: 243 a.a.     [Download]
>gi|387893606|ref|YP_006323903.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas fluorescens A506]
MTPMEAPWRSAGRTQRGLARLRNEDAFLDNPSTGCWAVADGMGGYRHGDVASQWIVSHLASVSADGNLDQ
RIQAVRNKLQDVNQGVRRAWTEPGATGEVTMGSTVVALLLEKGRAACLWAGDSRCYLWRDQSLYQLSKDH
SLLQRLMDERQLSVAQAQAYPGARALTRAVGARSRLHLEVLELRTRPGDVFLLCSDGLYQALSHVDLGRA
LSMGTPQRAVERLFAAALRRPIRDDLTAVVVQP
 
Nucleotide Sequence: 732 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2638082-2638813 Pseudomonas fluorescens A506 chromosome, complete genome
GTGACCCCGATGGAAGCCCCGTGGCGCAGCGCCGGGCGCACGCAGCGAGGCCTGGCGCGGTTGCGCAATG
AGGATGCATTCCTGGACAACCCGAGCACGGGTTGCTGGGCGGTGGCGGACGGCATGGGCGGGTATCGGCA
CGGGGATGTCGCCAGCCAGTGGATAGTCAGCCACTTGGCTTCAGTGTCGGCTGACGGCAACCTTGACCAA
CGTATTCAGGCGGTTCGCAACAAATTGCAGGACGTCAACCAAGGAGTACGACGCGCATGGACAGAACCTG
GCGCAACCGGTGAAGTGACGATGGGCAGCACCGTGGTCGCCCTGTTGTTGGAGAAGGGCCGGGCGGCCTG
CCTATGGGCGGGAGACAGTCGCTGCTATTTATGGCGCGACCAGAGCCTCTACCAATTGTCGAAGGACCAC
TCGCTGCTGCAGCGCCTCATGGACGAGCGTCAGTTGAGTGTGGCGCAAGCCCAGGCTTACCCGGGTGCCA
GGGCCTTGACCCGGGCCGTTGGCGCGCGTTCGCGGTTGCATCTGGAGGTACTGGAACTGCGTACCCGCCC
TGGGGATGTATTTTTGTTGTGCAGTGATGGCTTGTATCAGGCCCTCAGCCATGTTGACCTGGGGCGGGCG
TTGAGCATGGGCACGCCTCAACGGGCAGTGGAACGGCTATTTGCAGCGGCGTTGCGCCGGCCGATACGCG
ATGACCTGACTGCGGTTGTGGTGCAGCCTTGA
 Primer design