SecReT6
Protein ID: 387893607
SecReT6 ID656
T6SS typei1
Gene symbolstk1
Locus tagPflA506_2421
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2638810..2639652 [+]
Productserine/threonine protein kinase Stk1
NoteStk1
UniProt IDI2BZG2
KEGG IDpfc:PflA506_2421
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 1.30E-33, Aligned region: 15..226
Pkinase_Tyr [PF07714], Evalue: 6.90E-21, Aligned region: 16..223
APH [PF01636], Evalue: 0.00022, Aligned region: 61..135
APH [PF01636], Evalue: 0.00022, Aligned region: 121..167
Protein Sequence: 280 a.a.     [Download]
>gi|387893607|ref|YP_006323904.1| serine/threonine protein kinase Stk1 [Pseudomonas fluorescens A506]
MNSAAQACRLLSGRYHLERVLGRGGMGRVYRARDLLHEQLGEPCSKVAIKLLDEPISQCPDAHVLLYSEF
ALTRSLRHAHVVRAFSFEVDTHSQVAFFTMELLQGVTLDRLLLECPYGLPWRELRPIAVQLLDALVYTHQ
QDVLHGDVKPANVMVGEEGVRLFDFGLGQAQAGAAMGLPSVSRSRFNAWTPAYAAPELLAGGALTAAADL
YGVACVLYELAHGKRVGERASKVCLPRPAQLPRHCWVALQAALAIDPQHRSITVAELRHVMGRNRARWCL
 
Nucleotide Sequence: 843 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2638810-2639652 Pseudomonas fluorescens A506 chromosome, complete genome
TTGAACTCGGCAGCTCAAGCCTGCCGTTTACTGTCTGGGCGCTATCACCTTGAACGTGTCTTGGGCAGAG
GTGGCATGGGCAGGGTGTACCGCGCGCGCGACCTGTTGCACGAGCAATTGGGCGAACCCTGTTCCAAGGT
CGCGATCAAGCTACTCGACGAACCCATTTCCCAGTGCCCCGACGCGCATGTGTTGTTGTACAGCGAGTTT
GCGTTGACCCGCAGCCTGAGGCACGCGCATGTGGTACGGGCGTTTTCGTTTGAGGTCGATACACACAGTC
AAGTCGCGTTTTTCACCATGGAGTTGCTGCAAGGAGTGACGCTGGACCGCCTGCTGCTGGAGTGCCCCTA
TGGCTTGCCCTGGCGGGAGTTGCGACCCATCGCCGTGCAGTTGCTGGATGCGCTGGTCTACACCCACCAG
CAAGACGTTCTGCACGGTGATGTCAAACCAGCCAATGTCATGGTGGGCGAGGAGGGCGTGCGCTTGTTCG
ATTTCGGCCTGGGCCAGGCTCAAGCAGGCGCCGCAATGGGTTTGCCGAGTGTCAGCCGCAGTCGTTTCAA
TGCCTGGACACCTGCTTACGCCGCCCCGGAACTGTTGGCCGGCGGTGCGCTGACCGCCGCTGCCGACCTG
TACGGCGTGGCCTGCGTCCTGTACGAACTGGCCCACGGCAAGCGCGTTGGGGAGCGCGCCTCCAAGGTCT
GTCTGCCCCGGCCCGCGCAGTTACCCAGGCATTGCTGGGTGGCGTTACAGGCAGCGTTGGCGATAGACCC
GCAGCACCGAAGCATAACGGTCGCCGAGTTGCGTCACGTCATGGGGCGCAACCGAGCACGCTGGTGCTTG
TAG
 Primer design