SecReT6
Protein ID: 387896384
SecReT6 ID657
T6SS typei3
Gene symboltssM1
Locus tagPflA506_5295
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5794185..5797685 [-]
Producttype VI secretion protein TssM1
NoteTssM
UniProt IDI2BP17
KEGG IDpfc:PflA506_5295
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.00E-97, Aligned region: 76..122
ImcF-related_N [PF14331], Evalue: 5.00E-97, Aligned region: 188..450
IcmF-related [PF06761], Evalue: 1.10E-89, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 1.50E-40, Aligned region: 689..724
DUF1215 [PF06744], Evalue: 1.50E-40, Aligned region: 904..1025
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 405..420
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 618..640
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 769..802
AAA_19 [PF13245], Evalue: 0.0045, Aligned region: 124..141
Protein Sequence: 1166 a.a.     [Download]
>gi|387896384|ref|YP_006326681.1| type VI secretion protein TssM1 [Pseudomonas fluorescens A506]
MKAFFSFMIRWVIPVLGLIALSLIIWFVGPLLDVLVPEGRRWALIVLVFALWVAYRVFRIIQARRQAAEV
MRSLAAETPVDPNSVATAEELSTLRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSNSTVDKAAWLGFLDLLKKQRARR
PIDGAFIAISLSDLLLGTDAERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDNLSKEE
RAQVWGMTFALDDGKNSDSPLAHLQSEFAGLEQRLNERLVERLQQERDSARRDLIYGFPQQFGALKDCLQ
SFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQSGTGRSYFIEKLFTAV
AFAERGLVGVNPKVERRRKWIARGVLAATVALVVVVSGLWWVSYRANQAYIAQVDQKVAPLGQTVQNLSP
AQREVLAVLPLLNAVKNLAGDSPSWSEGLGLYQGDMLEAESASVYRKLLIAVFAPRLVTRIEEQLHGGGN
SDFLYEGLKAYLMLADTEHYDPDFIKAWIALDWDRNLPRDLPADQRQALAGHLQALFERHPPSARLDPRL
IDDLRRQLQQLPVAQRVYDRVKRQKLPEGIPDFRLNEAAGRDAALVFSRKSGKPLGEPLSGFFTAKGYRQ
AFLLSSLNQTGTLAEEQWVLGHEQADQQNVVSLAADVRRLYFQDYQRQWDALLADIDFVPITSVAQAADV
LRVISGPTSPLKKLLVAVARETDLQAEERQLAAKGVPVEGGVDKLKERLGSLLGEAQPTANAPAPADDPV
TAHFAELNSIVSKNEGEPAAIDGLLSDMNALYVQVSAMVGASGDALLGEAKNQAAAAATRVSLNAERQPP
LVQGMVKSVVNSTTNSMMGGVRNQLNAAWVSEVVNVYRQSLAGRYPMSPGSARDATLDDFGQFFGVGGVM
DNYFRKYLQPYVDTSAQTWRWQPGAAQKLGIAPGVLQTFQRAATIRDAFFRSGGTQPIVRFELKPVSMDP
TITQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRISIMPPSASGRSGITLDGPWAWFRLLEQSDLT
AGNSPDRFNLRLRVDGASIAYELRANSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3501 bp     [Download]
>gi|387891255|ref|NC_017911.1|:c5797685-5794185 Pseudomonas fluorescens A506 chromosome, complete genome
GTGAAGGCGTTTTTCAGTTTCATGATTCGCTGGGTGATCCCCGTGCTGGGCCTGATTGCCCTGAGCCTGA
TCATCTGGTTTGTTGGCCCGCTGCTGGACGTGCTGGTGCCCGAAGGGCGCCGTTGGGCGCTGATCGTGCT
GGTGTTTGCGCTGTGGGTGGCCTACCGCGTGTTCCGCATTATCCAGGCCCGTCGCCAGGCCGCCGAAGTG
ATGCGCAGCCTGGCCGCAGAAACCCCGGTCGACCCCAACAGCGTTGCGACCGCCGAAGAGCTGTCCACGC
TGCGCCAGCGCATGGACGAAGCCCTGGCACTGCTGAAAAAGGCCAAGCTGGGCGGCGATGAGCGCCGCAA
CCTCTACGAGTTGCCGTGGTACGTGATCATCGGCCCGCCGGGCTCGGGCAAGACGACCGCGCTGGTCAAT
TCCGGGCTGCATTTCCCACTGGCGGCGCAATTGGGCGCCGGTGCGGTGCGGGGCGTGGGGGGGACGCGCA
ACTGCGACTGGTGGTTTACCGACCAGGCCGTATTGCTCGACACCGCTGGCCGCTATACCACCCAGGACAG
CAACTCCACGGTGGACAAAGCCGCCTGGCTGGGCTTTCTCGACTTGCTGAAAAAGCAGCGTGCGCGCCGG
CCTATCGACGGTGCCTTTATCGCCATCAGCCTCTCGGATCTGCTGCTGGGCACCGACGCCGAGCGCGCAG
CCCATGCTGCCGCGATTCGCCTGCGCATCCAGGAGCTGTATACGCAACTGGGCGTGCGTTTCCCCATCTA
CCTGATGCTCACCAAGCTAGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAACCTGAGCAAGGAAGAG
CGCGCTCAGGTGTGGGGCATGACCTTTGCCCTGGACGACGGCAAAAACAGCGACAGCCCGCTGGCGCACC
TGCAAAGCGAATTCGCCGGCCTGGAGCAGCGCCTCAACGAACGCCTGGTCGAGCGCTTGCAACAGGAACG
CGACTCGGCACGACGCGACCTGATCTACGGCTTCCCGCAGCAGTTCGGCGCGTTGAAAGATTGCCTGCAA
AGCTTCCTCGAAGGCGTGTTCAAACCCAACGCCTTTGAAGAGCGCGTGTTGCTGCGTGGCGTGTACTTCA
CCAGCGGCACCCAGGAAGGCAGCCCGATTGACCGCCTGATCGGTGCCATGGCCCAGAGCATGAACCTGGA
CCGCCAGCACCTGGCGCGCCAGAGCGGCACCGGGCGCAGTTACTTCATCGAAAAACTGTTCACCGCCGTG
GCCTTTGCCGAGCGCGGCCTGGTGGGGGTGAACCCGAAAGTCGAGCGGCGCCGCAAGTGGATCGCCCGTG
GCGTACTGGCGGCCACCGTCGCGCTGGTGGTGGTGGTCAGCGGCCTGTGGTGGGTGAGCTATCGCGCCAA
CCAGGCATATATCGCCCAGGTCGATCAGAAGGTCGCGCCCCTGGGCCAGACCGTACAGAACCTGAGCCCG
GCACAGCGGGAAGTGCTCGCCGTGCTGCCGTTGCTCAATGCGGTGAAGAACCTGGCGGGGGATTCGCCGA
GCTGGTCCGAAGGGCTGGGGCTGTACCAGGGCGATATGCTCGAAGCCGAGTCCGCCAGCGTGTACCGCAA
ACTGTTGATCGCCGTGTTCGCGCCACGCCTGGTGACGCGTATCGAAGAGCAACTGCACGGCGGCGGTAAC
TCGGACTTTCTCTACGAGGGCCTCAAGGCTTACCTGATGCTCGCCGACACCGAGCATTACGACCCGGACT
TCATCAAGGCCTGGATCGCCCTGGACTGGGACCGCAACCTGCCCCGCGACCTGCCGGCCGACCAGCGTCA
GGCCCTGGCCGGGCACTTGCAGGCGCTGTTCGAACGCCACCCGCCGAGCGCACGCCTGGACCCACGGCTG
ATCGACGATTTGCGTCGGCAGTTGCAGCAGTTGCCGGTAGCCCAGCGCGTGTACGACCGCGTCAAGCGCC
AGAAACTGCCCGAAGGTATCCCGGACTTTCGCCTCAACGAAGCCGCCGGTCGCGATGCCGCGCTAGTGTT
CAGCCGCAAGAGCGGCAAGCCGTTGGGTGAGCCGTTGAGTGGTTTCTTTACCGCCAAAGGCTATCGCCAG
GCGTTCTTGCTCAGCAGCTTGAACCAGACCGGCACCCTGGCCGAAGAGCAATGGGTGCTGGGCCATGAAC
AGGCCGACCAGCAGAACGTGGTGAGCCTGGCCGCCGACGTGCGCCGTTTGTACTTCCAGGATTACCAGCG
CCAGTGGGACGCGTTGCTCGCCGACATCGACTTTGTGCCGATCACCAGCGTGGCACAGGCCGCCGATGTG
CTGCGGGTGATTTCCGGTCCCACCTCGCCGCTGAAAAAGCTGCTGGTGGCGGTTGCCAGGGAAACCGACC
TGCAAGCCGAAGAACGCCAACTGGCCGCCAAAGGCGTGCCGGTGGAAGGCGGCGTGGACAAGCTCAAGGA
GCGCCTCGGCAGTTTGCTGGGCGAGGCGCAACCGACGGCGAATGCACCGGCACCGGCGGATGATCCCGTG
ACCGCGCACTTTGCCGAACTCAACAGCATCGTCAGCAAAAACGAAGGTGAACCGGCGGCCATCGACGGCC
TGCTGTCGGACATGAATGCACTGTATGTGCAGGTCAGTGCCATGGTCGGTGCCAGCGGCGATGCCTTGCT
CGGTGAGGCCAAGAACCAGGCGGCGGCTGCGGCCACGCGGGTCAGCCTGAACGCCGAGCGTCAGCCGCCG
CTGGTGCAGGGCATGGTCAAGTCGGTGGTCAATTCCACCACCAACAGCATGATGGGCGGGGTGCGTAACC
AGCTGAACGCGGCCTGGGTCAGTGAGGTGGTCAACGTGTATCGCCAGTCGTTGGCCGGGCGTTACCCTAT
GTCGCCGGGCAGTGCGCGGGACGCCACCCTGGATGACTTCGGCCAGTTCTTCGGCGTGGGCGGGGTGATG
GACAACTACTTCCGCAAATACCTGCAGCCCTATGTGGACACGTCGGCACAGACCTGGCGCTGGCAACCGG
GGGCGGCGCAGAAGCTGGGAATTGCTCCTGGCGTGCTGCAAACCTTCCAGCGGGCGGCGACGATTCGGGA
CGCGTTCTTCCGCTCCGGTGGCACCCAACCCATCGTGCGTTTCGAACTCAAGCCGGTGTCGATGGACCCT
ACCATCACCCAGTTCCTGCTTGACCTGGACGGCCAGCAATTGAGCTACGACCACGGCCCGAGCCGGCCGG
TGGCGATGCAATGGCCGAACCCGGGCAGCATTGGCGTGGTGCGTATTTCCATCATGCCCCCGTCGGCCAG
TGGTCGCTCCGGCATCACTCTGGACGGCCCGTGGGCCTGGTTCCGTCTGCTGGAGCAATCAGACCTCACC
GCAGGCAACTCGCCGGATCGTTTCAACCTGCGCCTGCGAGTCGATGGCGCGAGCATCGCCTACGAGTTGC
GCGCCAACAGTGCCTTCAACCCGTTCAAGAGCCGCGTGCTCAGTGGCTTCAGCCTGCCGGAGCGGCTATG
A
 Primer design