SecReT6
Protein ID: 387901163
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0403
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]432668..436609 [-]
Producttransmembrane protein
NoteTssM
UniProt IDI2DJE5
KEGG IDbuk:MYA_0403
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-72, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 3.60E-52, Aligned region: 498..876
DUF1215 [PF06744], Evalue: 5.00E-30, Aligned region: 1009..1124
Protein Sequence: 1313 a.a.     [Download]
>gi|387901163|ref|YP_006331502.1| transmembrane protein [Burkholderia sp. KJ006]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAALAFAAILVLWLAVALWRRWRVKRANQQLG
QVLEEQAETGKITAPAAAALAPDTKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDEKRDVVTLFDERFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
ALRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAQRFGLDASALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPMSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGAMPVSTNPPGATPLAGAAQGASATPAAAPQQPAAPQGGLYSDASP
TNVQDAYNALKTYLMLADKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIKSAERMISFYLSRVNDDD
WPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLIAGSYAIPGTF
TREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIAV
QGFTSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQWFTRSQAGQM
AAANIDINGNPAEVPMGPIGQEFVGLARIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLM
QQTLDGNGSELADSLKFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFSVVIQPASAEVNKVWNAQVYQPFQ
SSLATKYPFAPNAKVEAGAGEIAQVFGPDGAIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTNG
FARWVAPLAGGAAGGAAAASEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPG
ATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWVQGSVNVSVTMRIISTSQPTGGGGD
QPQQQSLRGLQLPSSIADASAGAAQNATQAGAGAPAAAPAVAAATATNAQGAQ
 
Nucleotide Sequence: 3942 bp     [Download]
>gi|387900762|ref|NC_017920.1|:c436609-432668 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTAGCGG
CGATTCTCTTCATCGTCGCCGACATGCTGCAGCTGCCGCTGCTGTGGGCCGCGCTCGCGTTCGCGGCGAT
CCTCGTGCTGTGGCTCGCCGTCGCGTTGTGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAGCTCGGC
CAGGTGCTCGAAGAACAGGCCGAAACCGGCAAGATCACGGCGCCCGCCGCGGCCGCGCTCGCGCCCGACA
CGAAGACCGCCGACCTCGACGTGCTGCGCACGCGCCTGTCCGATGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCC
GCGGGCAAGAGCAGCGCGGTGCTGAACTCCGGCCTGCAGTTCCCGTTCGCCGACAAGAACAGCGCGGTGA
TCCACGGCATCGGCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGACACGGC
CGGCCGCTACTCGGTGCACGAGGAAGACCGCAGCGAGTGGCTCGGCTTTCTCGGCCTGCTGAAACGCTAC
CGGCCGAAGGCGCCGATCAACGGCATCATCGTCACCGCGAGCATCGCCGAGCTCACCGGCAACCGCCCCG
AGTTCGCGATCAACCTCGCGAAGAACCTGCGTCAGCGCGTCCAGGAGCTGACCGAAAAGCTCGAAGTGTT
CGCACCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAATACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAACCGGACGAGAAGCGCGACGTCG
TCACGCTGTTCGACGAGCGCTTCGAGGAGCTGTACGAGGGGCTGAAGGAGATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGCTCAGCTTCCCGCTCGAATTCTCGACGATCAAGCCG
GCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCACTGCAGGAAGGCGAGACCAACAGCGCCGCCGCGCAGCGCATCGCTCAGCGCTT
CGGCCTCGACGCGAGCGCGCTGCCGAAGCCGCACAGCGCATTTTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCGGACCGTCAGACCGTGCGCCAGTTCGCGAGCCCCACCAAGACGCGGC
TGCGTTACGCGACCTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTCGGCGGCTGGACCTGGTCGAC
GATCGGCAACCAGCAGCTCGTCGCCAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTGCAGCAGGGC
CGCAACGACCTGCAGTCGCGGCTGCAGGCGATGGACATTCTCGAAGACCGCATCGAGCAGCTCGAGCAGT
TCCGCCGCGACAAGCCGATGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGCCTCGAGCAGCATCTGCT
GACCGAGTACTACAACGGCGTGCGGCAGATCCTGCTCGCGCCGGTGTCGCAGAATCTCGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAGCAGCTCGTGCCGATGACGCGTCCGCCCGAATCGGGCGCGGTGCAGG
GCGGCGCGATGCCGGTCTCGACCAATCCGCCGGGCGCCACGCCACTCGCCGGCGCCGCGCAAGGCGCGTC
GGCCACGCCGGCCGCCGCGCCGCAACAGCCGGCGGCGCCGCAGGGCGGCCTCTACAGCGACGCGTCGCCG
ACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTCGCCGACAAGCGTCACGTCGAGC
AGGCGCACCTGACCGACCAGCTTGCGCGCTTCTGGCGCGGCTGGCTGGAGACGAACCGGGGCAACATGCC
GCGCGACGAGATGATCAAGAGCGCCGAGCGGATGATCTCGTTCTATCTGTCGCGCGTGAACGACGACGAC
TGGCCGATGATCGACGCGAACCTCGCGCTGGTCGACCAGACGCGCGAGAACCTGCGCCGCGTCGTGCGCG
GCATGCCGGCGCGTCAGCGCGTCTACGAGGAAATCAAGGCGCGCGCGTCGACCCGCTTCGCGCCGATGAC
CATCGCGCGCATCGTCGGCGACGGCAACCAGGGGTTGATCGCCGGCAGCTACGCGATTCCGGGCACGTTC
ACGCGCGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGCGACGCGGCGACCAAGGAACTGCAGGCGA
AGGACTGGGTGCTGAACACGTCGACGCAGGACGACCTGACGCTCGAGGGTAGCCCCGAGCAGATCCAGAA
GACGCTGGTCGGCATGTACAAGACCGAATACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCGGTG
CAGGGCTTCACGAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTGGGCGACCCGCAGGATTCGCCGA
TCCGCAAGATCCTCGAGACCGCGTACGACCAGACCTCGTGGGACAACCCGTCGCTCGCGAACGTGACGAT
CAAGAAGGCGCAGACGGGCGTCGTGAACTGGGTGAAGCAGTGGTTCACGCGCTCGCAGGCCGGCCAGATG
GCCGCCGCGAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAGTTCG
TCGGGCTCGCGCGGATCGTCGCGACGCACGACGGCACGTCGATGCTCAAGGGCTACATGGACACGCTGTC
GAAGGTGCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCCGGCCCCGGCGCGCGTCAGCTGATG
CAGCAGACGCTCGACGGCAACGGCTCGGAGCTGGCCGATTCGCTGAAGTTCGTCGACGAGCAGATGCTGA
CGGGCCTCACCGATTCGCAACGCAAGTCGCTGCGTCCGCTGCTGGTGCGGCCGCTGATGCAGGCGTTCTC
GGTCGTGATCCAGCCGGCCAGCGCGGAAGTGAACAAGGTCTGGAACGCGCAGGTGTACCAGCCGTTCCAG
AGCTCGCTCGCGACCAAGTACCCGTTCGCGCCGAACGCGAAGGTCGAGGCCGGCGCCGGTGAAATCGCGC
AGGTGTTCGGTCCGGACGGCGCGATCGCGAAGTTCGTCGGCACGACGCTCGGGCCGCTCGCGGTGCGCCG
CGGCGACACCCTCGCCGCGCGCACGTGGGGCGACATGGGCATCGGCCTCACGCCGGACTTCACGAACGGC
TTCGCGCGCTGGGTCGCGCCGCTCGCGGGCGGTGCGGCAGGCGGCGCGGCCGCCGCGTCCGAACCGCAGA
CCGTGTTCCAGATCCTGCCGCAGCCGAGCACCGGCACGACCGAATACACGATCGCGATCGACGGCCAGCA
ACTGCGTTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAACCCGCAGGGTTCGCCCGGC
GCGACGCTGTCCGCGACGACCTTCGACGGCCGCACCGTGCAGCTCGTCAACGAGCCTGGCCGCTACGGTC
TCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGCCCGGACGGCACGTTCGATCTGACGTGGGTTCA
GGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAGCCGACCGGCGGCGGCGGCGAC
CAACCTCAGCAGCAGAGCCTGCGCGGTCTGCAGCTGCCGTCGTCGATCGCCGACGCGAGCGCCGGCGCCG
CACAGAACGCGACGCAGGCGGGCGCCGGCGCGCCGGCCGCGGCACCGGCCGTCGCGGCCGCCACCGCAAC
GAATGCACAGGGGGCGCAATGA
 Primer design