SecReT6
Protein ID: 387904822
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4071
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1231083..1231514 [-]
Producthypothetical protein
NoteTssE
UniProt IDI2DUV3
KEGG IDbuk:MYA_4071
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.90E-18, Aligned region: 31..116
Protein Sequence: 143 a.a.     [Download]
>gi|387904822|ref|YP_006335160.1| hypothetical protein MYA_4071 [Burkholderia sp. KJ006]
MWTGPGLFERITRHFADGSAVDDFAAEVQVFLSVRDNIERILNSRRGSLAHLPDYGLDDLSAIYRHLPSS
AHKLQRAIEATLLAYEPRLKKVEIEIHPPEPGMLISFTMACHLHREGLVRFGTNFMPDGKTRLRMLQAAL
DRY
 
Nucleotide Sequence: 432 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1231514-1231083 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGTGGACAGGTCCTGGGTTGTTCGAGCGAATCACCCGACATTTTGCGGACGGTTCGGCAGTAGACGACT
TCGCCGCGGAGGTTCAGGTCTTTCTTTCGGTTCGCGACAATATCGAGCGCATCTTGAACAGCCGACGCGG
ATCGCTCGCTCATCTCCCGGACTACGGGCTGGATGACCTATCGGCGATCTATCGGCATCTGCCGTCCTCC
GCGCACAAGCTCCAGCGCGCGATCGAGGCCACCCTGCTCGCCTACGAACCGCGGCTCAAGAAGGTGGAAA
TCGAAATTCATCCGCCCGAACCAGGCATGTTGATCAGCTTCACGATGGCTTGTCATTTGCATCGCGAAGG
CTTGGTCCGCTTCGGCACGAATTTCATGCCGGACGGTAAGACCCGCCTGCGCATGCTCCAGGCTGCACTG
GATCGGTACTGA
 Primer design