SecReT6
Protein ID: 387904823
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4072
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1231527..1232012 [-]
Producthypothetical protein
NoteTssL
UniProt IDI2DUV4
KEGG IDbuk:MYA_4072
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.60E-30, Aligned region: 2..150
Protein Sequence: 161 a.a.     [Download]
>gi|387904823|ref|YP_006335161.1| hypothetical protein MYA_4072 [Burkholderia sp. KJ006]
MINDAVYALCALLDEAALKHLTGEARESWEKRPLQEERFSRNDAGEELVRRIEDRLLEPRSPRVLLAIFA
AVLSLGFTGRFAMDGSTARAALIRTLDERLGRTTAAEDNPAAAASIVVNSTDARPQRISPLTWVVASCVA
VGVAWFMVDRWFIASIAQLAR
 
Nucleotide Sequence: 486 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1232012-1231527 Burkholderia sp. KJ006 chromosome 2, complete sequence
GTGATCAACGATGCGGTCTACGCGCTGTGCGCACTGCTCGACGAGGCCGCATTGAAGCACCTCACGGGAG
AAGCTCGCGAAAGCTGGGAGAAGCGGCCGCTCCAGGAGGAACGTTTCTCGAGAAACGATGCCGGCGAGGA
GTTGGTACGACGCATCGAGGATCGCTTGCTCGAGCCACGGTCGCCGCGGGTGCTGCTTGCGATATTCGCC
GCGGTGCTGTCGCTTGGCTTCACCGGACGGTTTGCGATGGACGGGAGTACAGCGCGTGCGGCGCTTATTC
GCACCCTCGACGAACGGCTTGGGCGCACGACTGCGGCGGAGGACAACCCCGCAGCGGCTGCTTCGATCGT
GGTGAACAGCACCGACGCCCGCCCGCAGCGCATTTCTCCGCTGACTTGGGTGGTCGCCTCGTGCGTCGCC
GTCGGCGTCGCCTGGTTCATGGTCGATCGATGGTTCATCGCGTCGATTGCTCAGCTGGCGCGATAG
 Primer design