SecReT6
Protein ID: 387904824
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4073
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1232186..1233493 [-]
Producthypothetical protein
NoteTssK
UniProt IDI2DUV5
KEGG IDbuk:MYA_4073
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.00E-132, Aligned region: 5..432
Protein Sequence: 435 a.a.     [Download]
>gi|387904824|ref|YP_006335162.1| hypothetical protein MYA_4073 [Burkholderia sp. KJ006]
MTPQHFQQQAIWEQYVHDRVARIASPDAWGAVNVALDSEALSVNRLQCTALGLRLPDGTLIDSETADWLP
AARSLDDVPTTVDTVTVLAGVALMDAQGGNCVEPGEKPARPRRVTREYKHVADLNGDGQEEISVERNVVA
LLFDFEQAGDYVTCPIARLVRTPQGRFEQDKSFVPPCLFLSASDRLVHRAQRISEILSAKSASLAVRRKE
RSDQIADFAVSDVALFWLLHSVNSTWPELARLVQAPDQHPERLYAVLARLAGSLLTFSTTESLQAIPLYD
HHAPEPMFAELESLIRTLLDAVIPSRVVPIALERVRATIWVGRINDERLTEGAEYYLSVQAAMPAHALIE
HLPRLCKVGAPDEVEQIVNSALLGIALRPMSRLPAAIPVRIENQYFALDSNDAAFKRMIDAHACQIYVPA
SIPEASLELYAVLPS
 
Nucleotide Sequence: 1308 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1233493-1232186 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGACGCCGCAGCACTTCCAGCAGCAGGCGATATGGGAACAATACGTCCATGACCGTGTAGCACGTATCG
CGAGCCCCGACGCTTGGGGTGCCGTCAACGTTGCGCTCGACAGCGAAGCACTGAGCGTCAATCGACTGCA
GTGCACGGCGCTCGGGCTGCGCCTGCCGGACGGTACGCTGATCGATAGTGAAACGGCCGACTGGCTTCCT
GCGGCACGCAGTCTCGACGACGTGCCGACAACGGTCGACACTGTGACCGTGCTTGCTGGTGTAGCACTGA
TGGACGCTCAGGGCGGCAACTGCGTCGAACCCGGCGAAAAGCCTGCGCGGCCGCGGCGCGTGACCCGCGA
ATACAAGCACGTTGCCGATCTGAACGGCGACGGACAGGAAGAAATCAGTGTCGAGCGCAACGTGGTAGCC
CTTCTGTTCGACTTCGAGCAGGCCGGAGACTACGTCACCTGTCCGATCGCGCGGCTCGTGCGCACGCCAC
AAGGGCGGTTCGAACAGGACAAGAGCTTCGTCCCGCCGTGCCTGTTCCTGTCGGCGAGCGATCGCCTCGT
GCATCGCGCGCAGCGCATCTCCGAAATCCTGTCTGCCAAGAGCGCCAGCCTTGCGGTGCGCCGCAAAGAG
CGCTCGGATCAGATCGCCGATTTCGCCGTGTCCGACGTGGCGCTCTTCTGGCTATTGCATAGCGTCAATA
GCACCTGGCCCGAACTCGCCCGTCTCGTACAGGCGCCAGACCAGCATCCGGAACGGCTCTACGCCGTGCT
TGCCCGCTTGGCCGGTTCACTGCTGACGTTCTCTACGACCGAGTCGCTCCAGGCGATTCCGCTATACGAT
CACCACGCACCGGAGCCGATGTTTGCCGAGCTCGAATCGCTGATCAGAACACTGCTCGACGCCGTGATTC
CGTCCCGAGTCGTGCCGATTGCACTCGAGCGCGTGCGCGCGACCATATGGGTTGGCCGAATCAACGACGA
GCGGCTGACGGAAGGCGCTGAATACTATCTGTCGGTTCAGGCCGCCATGCCCGCACACGCCCTCATCGAG
CACCTGCCGCGCCTCTGCAAGGTCGGCGCACCGGACGAAGTCGAGCAGATCGTCAATTCCGCACTGCTCG
GCATCGCACTGCGACCGATGTCGCGCCTGCCTGCCGCGATTCCCGTGCGGATAGAAAACCAGTACTTCGC
GCTGGACAGCAACGATGCCGCGTTCAAACGGATGATCGACGCGCATGCCTGCCAGATCTACGTGCCGGCG
TCGATTCCTGAAGCGTCGCTCGAGCTGTATGCGGTGCTGCCGTCATGA
 Primer design