SecReT6
Protein ID: 387904825
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4074
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1233587..1234909 [-]
Producthypothetical protein
NoteTssC
UniProt IDI2DUV6
KEGG IDbuk:MYA_4074
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-166, Aligned region: 14..436
Protein Sequence: 440 a.a.     [Download]
>gi|387904825|ref|YP_006335163.1| hypothetical protein MYA_4074 [Burkholderia sp. KJ006]
MRINTIACIDSDLIDWYLAELDDQLGRQLDAILHHCAFQTLESTWRGLQFLVDRTDFRQNVKIEVLDVSK
EALRQDFEDAPDIIQSGLFRLTYVGEYDMPGGQPIAAIVSAFEFDHGGPDIALLRNISKVAAAAHMPFIG
AVSPAFFGKTTMEAVAGIRDLPSWFERAEYLKWKGFRETEDARYIALTMPRFLARLPYGFDTMPVRAFNY
TENVRESGRSAYLWTSAAFAFAVNIVRSFVRNGWCVQIRGPQAGGVINDIPAHRYDLGAGQLGKISTDAL
ISETRENEFADIGLIPLSYTRNHDQTCFFSAHSTQRPRSYDARDASANSRINARLPYIFLLSRIAHYLKL
IQRENIGTTRDSRLLELELNTWIKSLVTEMTDPGDELQAAHPLRHAKVTVEDIEDNPGFFRIKLFIVPHF
QIEGVDINLSLVSQMPKAKH
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1234909-1233587 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGCGCATAAATACGATTGCGTGCATCGATTCCGATTTGATCGATTGGTATCTGGCTGAATTGGACGATC
AACTCGGCAGACAGCTCGACGCCATCCTCCACCACTGCGCATTTCAGACACTCGAATCGACGTGGCGCGG
CCTGCAATTCCTGGTGGATCGGACTGATTTTCGACAAAACGTCAAAATCGAGGTGCTTGATGTCTCGAAA
GAAGCGCTGCGTCAAGACTTCGAAGATGCACCGGACATCATCCAGAGTGGCCTGTTCCGGCTGACATACG
TCGGCGAATACGACATGCCGGGCGGGCAGCCCATCGCCGCGATCGTCTCGGCCTTTGAATTCGATCACGG
CGGCCCGGACATCGCACTATTGCGCAATATCTCGAAAGTCGCGGCCGCGGCCCATATGCCGTTCATCGGC
GCCGTCTCGCCTGCGTTCTTCGGGAAAACCACGATGGAAGCCGTCGCAGGCATCCGCGATCTGCCGAGCT
GGTTCGAGCGGGCCGAATACCTGAAGTGGAAAGGCTTCCGTGAAACTGAGGATGCACGCTACATCGCGCT
CACAATGCCGCGATTCCTTGCACGTTTGCCGTACGGATTCGATACGATGCCCGTGCGCGCATTCAATTAC
ACCGAGAATGTCAGGGAATCTGGTCGCAGCGCATATCTGTGGACAAGCGCGGCGTTCGCTTTTGCGGTCA
ATATCGTGCGCAGCTTCGTACGAAACGGTTGGTGTGTGCAGATTCGCGGCCCGCAAGCGGGTGGCGTCAT
CAATGACATTCCCGCGCATCGGTACGACCTCGGCGCCGGGCAACTGGGTAAGATTTCCACGGACGCATTG
ATTTCGGAAACACGCGAGAATGAATTCGCCGATATCGGCCTAATTCCCCTTTCGTATACCCGCAATCACG
ATCAAACGTGTTTCTTCTCGGCGCATTCAACGCAACGGCCGCGATCTTACGATGCACGCGACGCCTCCGC
GAATAGCCGGATCAATGCCCGTTTACCGTACATCTTCTTGCTGTCACGGATCGCACATTACCTGAAGCTC
ATCCAGCGCGAAAACATCGGCACGACGCGCGATAGCCGATTGCTGGAGCTCGAGCTGAATACCTGGATTA
AATCGCTTGTCACGGAAATGACCGATCCCGGCGATGAACTTCAGGCGGCACACCCGCTGCGGCACGCCAA
GGTCACGGTCGAGGACATCGAGGACAACCCGGGGTTCTTCCGCATCAAGCTGTTCATCGTCCCGCATTTT
CAGATCGAGGGCGTCGACATCAACCTCTCCCTGGTTTCGCAGATGCCTAAAGCGAAACATTGA
 Primer design