SecReT6
Protein ID: 387904826
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4075
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1235364..1237745 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDI2DUV7
KEGG IDbuk:MYA_4075
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 6.20E-49, Aligned region: 541..695
Phage_GPD [PF05954], Evalue: 1.30E-41, Aligned region: 15..289
T6SS_Vgr [PF13296], Evalue: 6.70E-34, Aligned region: 423..529
Phage_base_V [PF04717], Evalue: 1.10E-06, Aligned region: 321..414
Sarcoglycan_1 [PF04790], Evalue: 0.0019, Aligned region: 614..659
Protein Sequence: 793 a.a.     [Download]
>gi|387904826|ref|YP_006335164.1| Rhs element Vgr protein [Burkholderia sp. KJ006]
MVLTHPLQLARTDYLNRDAVCTIVPDDGVPHRFSGFIARFSTLQTTADFTKYEIVLKSHFARLEAVSTSR
IYQHQTTPQIIEAVLRSHGLEGHQFAFRLRREYPKHLFRFQYKLDDLSYVQMLMQKAGIYSYIVETEHGD
QVVFADDVDHYQWDPHLTAAYRETAGLEATGAEAVTALKTHTVTVPQSFVVADYNPEQAWERFRDDANVA
PQDPTTYGQTYVYGTHHLDQDGAKWEAQLRHEAAIAWQIVYEGESNVLALQAGRVLNLDTVLPDAPDGQV
VIEVTHRGARDRAYTNSYKAIPANRRFRLQLEDAKWPKIAGTLSARVTSPDNYKYAYLTAAGYYTVRFDV
DFADWPAGGESVPLRLAKPFAGKLQTGFHFSALDNDEAVIAFRDADPDKPEIIGFHHHSQARDLVTSDRR
WLSRNVIRTQSNNKLRMEDWAGQEGVKLSTEHSGTSHLDLGYLVDEKLERRGEGFELRTSGHGVERAGKG
LHLTAYDRPGASGKQLDMQETIAQLEQALALAKSLGDAARTAKAIPAGTDAQQQMKDEFDGLKQPGLLAS
APASIGVVAGGGVQMAAKESISAVAGKNADFSVMKRFTAAAGEAVSLFAQKLGIKIFAAKGPVELQAQSN
AMALTAEKDVSIASANGKVNLSAAKELILECGGAFIKIADGNITLGGPGDLFLKVLTIQKQGAQSLNLPV
PQLPVPAGIEMFSQRLDVSPLLGKEFSLPLHHIPYAVKDSTGRIVDSGMLDEAGYTGRTFTKQSSKLKYH
IGNDPWRLFLDSKHAEIDNEPQE
 
Nucleotide Sequence: 2382 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1235364-1237745 Burkholderia sp. KJ006 chromosome 2, complete sequence
GTGGTGCTCACGCATCCGCTGCAGCTGGCCCGCACTGACTATCTGAATCGCGACGCGGTCTGCACGATCG
TGCCTGACGATGGTGTGCCACATCGTTTCTCCGGTTTTATCGCGCGCTTCTCGACGCTGCAGACCACCGC
GGACTTCACCAAGTACGAGATCGTGCTGAAGTCGCACTTCGCGCGACTGGAAGCGGTGAGCACCAGCCGT
ATCTACCAGCACCAGACGACGCCGCAGATCATTGAGGCAGTGCTGCGCAGCCATGGCTTGGAAGGCCACC
AGTTCGCATTCCGGCTGCGCCGCGAGTATCCGAAGCACCTGTTCCGCTTCCAGTACAAGCTCGACGACCT
GTCGTATGTTCAGATGCTGATGCAGAAGGCCGGCATCTACAGCTACATCGTCGAGACCGAGCATGGCGAT
CAGGTGGTGTTTGCCGACGACGTCGACCATTACCAGTGGGACCCGCACTTGACGGCGGCGTATCGCGAGA
CTGCGGGGCTGGAGGCGACCGGCGCCGAGGCGGTGACCGCACTCAAGACGCATACGGTGACCGTGCCGCA
GTCGTTTGTCGTGGCCGATTACAACCCCGAGCAGGCGTGGGAGCGTTTCCGGGACGACGCAAACGTTGCA
CCGCAGGATCCGACCACGTACGGCCAGACCTACGTCTACGGCACTCACCATCTCGATCAGGACGGCGCGA
AATGGGAGGCGCAACTGCGCCATGAAGCGGCGATCGCATGGCAGATCGTGTACGAAGGCGAGAGCAACGT
GCTGGCGCTGCAGGCCGGGCGCGTGCTGAATCTCGACACGGTATTGCCCGATGCACCCGACGGACAGGTG
GTGATCGAAGTGACGCATCGCGGCGCGCGCGATCGGGCCTATACGAACAGCTATAAGGCGATTCCCGCTA
ACCGGCGCTTCCGGCTCCAGCTCGAAGACGCGAAGTGGCCGAAGATTGCCGGGACGCTGAGCGCTCGGGT
GACGAGCCCCGACAACTACAAATACGCTTACCTGACGGCGGCAGGCTACTACACGGTCCGGTTCGACGTG
GACTTCGCGGACTGGCCGGCGGGCGGGGAAAGCGTGCCGCTGCGGCTGGCAAAGCCCTTCGCGGGCAAGT
TACAGACGGGCTTCCACTTCTCGGCGCTGGACAACGATGAAGCGGTGATCGCGTTCCGGGACGCGGACCC
CGACAAGCCGGAGATCATCGGTTTCCACCATCACAGTCAGGCGCGCGATCTGGTGACGAGCGATCGCCGC
TGGCTGTCGCGCAACGTGATTCGCACGCAGTCGAACAACAAACTGCGGATGGAGGACTGGGCGGGGCAGG
AGGGCGTCAAGCTCAGCACCGAGCATTCGGGTACGAGCCATCTCGATCTTGGCTATCTGGTCGACGAGAA
ACTGGAGCGGCGCGGTGAGGGTTTCGAACTGCGCACGTCGGGTCACGGTGTCGAGCGCGCGGGCAAGGGG
CTGCATCTGACGGCCTACGACCGCCCGGGTGCGAGCGGGAAGCAACTCGACATGCAGGAGACGATCGCGC
AACTGGAGCAGGCGCTGGCGTTGGCGAAGTCGCTGGGCGACGCGGCGCGTACGGCTAAGGCGATTCCGGC
CGGCACGGATGCGCAACAGCAGATGAAGGACGAGTTCGACGGTCTGAAGCAGCCGGGCTTACTGGCGAGT
GCGCCGGCCTCGATCGGCGTCGTGGCAGGCGGCGGCGTGCAGATGGCTGCGAAGGAGAGTATCTCGGCGG
TGGCTGGCAAGAACGCTGACTTCAGCGTGATGAAGCGTTTCACGGCGGCCGCGGGCGAGGCGGTCTCGTT
GTTCGCGCAGAAGCTTGGAATCAAGATCTTTGCGGCTAAGGGGCCAGTCGAGTTGCAGGCGCAGAGCAAC
GCCATGGCACTCACGGCAGAGAAGGATGTAAGCATCGCCAGTGCGAACGGAAAGGTGAATCTCTCCGCCG
CGAAAGAACTCATTCTCGAGTGTGGCGGGGCGTTCATCAAGATCGCGGACGGCAATATCACACTGGGCGG
CCCGGGCGACCTATTCCTGAAAGTACTCACCATTCAGAAGCAGGGAGCGCAGTCTCTGAATCTGCCGGTT
CCGCAATTGCCCGTCCCCGCTGGCATTGAAATGTTCAGCCAACGGCTCGATGTCAGTCCGCTGCTCGGCA
AGGAATTCTCGCTTCCCTTGCACCATATTCCGTATGCGGTGAAAGACTCAACCGGGCGGATCGTTGATAG
CGGCATGCTCGACGAAGCAGGGTATACGGGGCGTACGTTCACCAAACAGTCTTCAAAGCTGAAGTACCAC
ATCGGCAACGATCCTTGGCGTCTGTTTCTCGACTCGAAGCACGCCGAGATCGACAACGAGCCTCAGGAAT
AG
 Primer design