SecReT6
Protein ID: 387904828
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4077
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1241960..1245523 [+]
Producthypothetical protein
NoteTssM
UniProt IDI2DUV9
KEGG IDbuk:MYA_4077
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.00E-72, Aligned region: 409..727
DUF1215 [PF06744], Evalue: 4.50E-37, Aligned region: 850..975
Protein Sequence: 1187 a.a.     [Download]
>gi|387904828|ref|YP_006335166.1| hypothetical protein MYA_4077 [Burkholderia sp. KJ006]
MTLKRRILGRCLLVIAAIAAVTALILYTVDLKDLKAWFSQNRLAILGAGVMLLAAIGLTLQRRGLVQLGA
QQASKDHGLEPPPPINPAADAGKKQVESAALQLKDLRFQMKQIRWFRWAYTRPWLLLTGDETTIGRLLPE
LKERGWLLMDDAVLLWGRTGSDGRPDEMWLKQIRCFRRTRPLDAIILMVDESTLLPDAVRGTTSPWGIHL
ARITHLLRWSAPVFILDLDGTDTVHRVDTPVTGCEIPHAADAPAIETALLELRHRLADVSVGQLAHNPAD
RYASDLSIRLDTRSAPLARWIASLSDWQRRAQPVAGVMFAPWPASGATTTGTDSLHFPLWRYLTDAARRT
PGRRTATHPFTMVSGIALAAVGLWGAGMLISGLTNARGLALTNDVLRTFNGANSPATRLRALLALQQRIE
FYEARVERPTLFSRFGLNHDQDVLTALWKPYAREARPQLLAPVQQDIEGQLVDLTQMPTTQVDDQVNRLA
RDGHAALKTYLMMADPSRADAAFMTPQLVRHWNGGIGLSPGEKLDLSQRLLAFYAQHLGAHPDWRIAARD
ELVAGARQTLLAVIGVKNSEDTIYQGILESVGHKYPDQTLASLTDGTDTRGLLKTTASVPGAYTRQAWDG
TIEAAIDDMAKRNGVTADWVLGATGANRNASAATPEALRASLRTRYFADYADRWQTFMNSITCEPARTLP
AAVAQLKLIADSRQSPVISLMKSLEFQGGAGVVKTSLSDTLVNKAQNMFASKDNAPQPAAPDPAGPLGVS
FGPVLHLIAPGNAATAGATSDLSLQRFIERITMLRLKLQQIADSPDADSESRQVAQSLFQGKSSELADTL
AYAQLVAASLGEQWAGMGQSLFVQPVTQATQAILEPAQASLNDAWRQTVVASWNRSFAGRYPFANTNNDA
SLPELSRFLRPQGGLVGSFLATQLAGVLTLQGDQWVPASSGSGASSAARTIDPAFLNAINMLQRIANHLL
AQGEPQYAFDLKPVPSLGVTDTRLTVDGQKLHYYNQQETWQTFTWPSNEPQKAGTRLEWQTERAGTNLNM
EFGGRWALVRLLERAHVSPVDTATYLITWQAAPQAPQSKAGAAKTDDGESLTAQAPLAPAPASLAYPLTY
LMRTDVGKGPLELLALRGFALPSRVFVPRTTPSRAAGTALQPPPLPPGALAAARHASVPIPGGALPE
 
Nucleotide Sequence: 3564 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1241960-1245523 Burkholderia sp. KJ006 chromosome 2, complete sequence
GTGACGTTGAAAAGACGCATATTGGGCCGGTGCCTGCTCGTCATCGCGGCGATCGCGGCCGTGACGGCGT
TGATTCTGTACACCGTCGATCTCAAGGATCTGAAGGCGTGGTTCTCCCAAAATCGGTTAGCTATCCTCGG
CGCTGGAGTGATGCTGTTGGCAGCGATCGGTCTCACTTTGCAGCGACGCGGGCTCGTGCAGCTCGGTGCG
CAGCAGGCGTCCAAAGATCATGGGCTCGAGCCTCCTCCTCCGATCAACCCCGCTGCCGACGCCGGGAAGA
AGCAGGTTGAATCGGCCGCCTTGCAGTTGAAAGACCTCCGCTTCCAGATGAAGCAAATCCGATGGTTTCG
ATGGGCTTATACGCGCCCCTGGCTGCTGTTGACGGGCGACGAGACAACTATTGGCCGCTTGTTGCCCGAG
CTCAAAGAACGCGGTTGGCTGCTCATGGATGACGCGGTGCTGCTGTGGGGACGCACCGGATCGGACGGTC
GTCCCGACGAGATGTGGCTGAAGCAGATTCGTTGCTTTCGTCGCACGCGTCCGCTCGACGCGATCATCCT
GATGGTCGACGAATCGACATTGCTGCCCGACGCAGTTCGCGGCACGACAAGTCCATGGGGCATCCACCTC
GCGCGTATCACGCACCTGCTGCGTTGGTCTGCGCCGGTATTCATCCTCGATCTCGACGGCACGGACACCG
TTCACCGTGTGGATACGCCCGTCACCGGTTGTGAAATCCCGCACGCTGCTGATGCGCCTGCAATCGAAAC
CGCGCTACTCGAATTACGCCATCGCTTGGCCGACGTCAGTGTCGGCCAGCTCGCGCACAACCCTGCCGAC
CGCTACGCGTCAGATCTCTCGATCCGTCTCGATACGCGCAGCGCACCGCTGGCTCGCTGGATCGCGAGCT
TGTCCGACTGGCAACGTCGTGCCCAACCGGTTGCCGGTGTGATGTTCGCACCGTGGCCGGCATCCGGAGC
GACGACAACGGGCACCGACAGTCTTCACTTTCCGTTGTGGCGCTATCTGACCGATGCAGCCAGGCGTACG
CCGGGCCGCCGCACGGCGACGCATCCTTTCACGATGGTCTCGGGAATTGCGCTGGCCGCCGTCGGACTGT
GGGGCGCCGGCATGCTCATCTCGGGCCTGACGAATGCCCGCGGCCTGGCGCTGACGAATGACGTGCTTCG
CACGTTCAACGGCGCCAACAGTCCGGCGACCCGTCTGCGCGCCTTGCTCGCGCTCCAGCAGCGCATCGAG
TTCTACGAAGCGCGCGTCGAGCGTCCGACACTGTTCTCGCGCTTCGGCCTGAATCACGATCAGGACGTGC
TCACCGCATTATGGAAGCCCTATGCGCGCGAAGCGCGCCCGCAACTGCTTGCGCCCGTGCAACAGGACAT
CGAGGGGCAACTGGTCGATCTCACGCAGATGCCGACCACCCAAGTCGATGACCAGGTCAATCGTCTCGCT
CGCGACGGTCACGCCGCGCTCAAGACGTACCTGATGATGGCGGACCCGTCGCGCGCCGATGCAGCGTTCA
TGACGCCGCAACTGGTGCGCCATTGGAACGGCGGCATCGGACTGTCTCCGGGCGAAAAGCTCGACCTGTC
GCAGCGGCTGCTGGCGTTCTACGCGCAGCACCTCGGCGCGCATCCCGACTGGCGCATCGCCGCGCGCGAC
GAGCTCGTCGCGGGCGCCCGCCAGACCTTGCTCGCCGTGATCGGCGTGAAAAACTCGGAAGACACGATCT
ATCAGGGCATCCTCGAATCGGTCGGCCACAAGTACCCGGACCAGACGCTCGCGTCTCTGACCGATGGCAC
CGACACGCGCGGACTGCTGAAAACCACGGCCAGCGTGCCCGGCGCGTACACGCGTCAGGCATGGGACGGG
ACCATCGAGGCCGCGATCGACGACATGGCGAAACGCAATGGCGTGACGGCCGACTGGGTGCTCGGCGCGA
CCGGCGCCAATCGCAACGCGTCGGCCGCGACGCCCGAGGCGCTGCGCGCGTCGTTGCGCACGCGCTACTT
CGCGGACTATGCGGACCGTTGGCAAACCTTCATGAACAGCATCACGTGCGAACCGGCGCGGACCTTGCCG
GCCGCCGTCGCGCAGTTGAAACTCATCGCCGATTCGCGGCAGTCGCCGGTGATCTCGCTGATGAAGTCGC
TCGAGTTCCAGGGCGGAGCGGGCGTCGTGAAGACATCGCTGTCCGACACTCTGGTGAACAAGGCGCAGAA
CATGTTCGCGAGCAAGGACAATGCGCCGCAGCCGGCCGCGCCCGACCCGGCCGGACCGCTCGGCGTGTCG
TTCGGCCCCGTGTTGCATCTGATCGCACCGGGGAACGCTGCGACGGCAGGCGCAACGAGCGACCTGAGCC
TGCAGCGTTTCATCGAACGCATCACGATGCTGCGTCTGAAGCTGCAACAAATCGCCGACAGCCCGGACGC
CGATAGCGAGTCGCGACAAGTCGCGCAGTCGCTGTTCCAAGGCAAGAGTTCGGAACTGGCCGACACGCTC
GCCTATGCGCAGCTTGTCGCCGCCAGTCTCGGCGAGCAGTGGGCGGGGATGGGGCAGTCGTTGTTCGTGC
AGCCGGTCACGCAAGCCACTCAGGCCATTCTGGAGCCGGCACAGGCGAGCTTGAACGACGCATGGCGCCA
GACCGTCGTCGCGAGCTGGAACCGCTCGTTTGCCGGCCGCTATCCGTTCGCCAACACCAACAACGACGCA
TCGTTGCCCGAGCTGTCGCGCTTCCTGCGACCGCAGGGCGGCTTGGTCGGCTCGTTCCTCGCCACGCAGC
TGGCGGGCGTGCTGACGTTGCAGGGCGACCAATGGGTGCCGGCATCGAGCGGTTCAGGCGCGAGCAGCGC
GGCGCGCACGATCGATCCGGCCTTTCTCAATGCGATCAACATGCTGCAGCGGATCGCCAATCACCTGCTG
GCGCAGGGCGAGCCGCAGTACGCATTCGACCTCAAACCGGTACCCAGCCTCGGCGTGACGGACACGCGCC
TGACGGTAGACGGTCAAAAGCTGCACTACTACAACCAGCAGGAGACGTGGCAGACGTTCACGTGGCCGTC
GAACGAGCCGCAGAAGGCCGGCACGCGTCTCGAATGGCAGACCGAGCGAGCGGGCACGAACCTGAACATG
GAATTCGGCGGCCGGTGGGCGCTGGTCCGGCTGCTGGAGCGAGCACACGTGAGCCCGGTGGATACGGCCA
CCTATCTGATCACTTGGCAGGCCGCGCCGCAGGCGCCGCAGTCGAAGGCAGGCGCCGCGAAGACGGACGA
TGGCGAGTCGTTGACCGCGCAGGCGCCGCTCGCTCCCGCGCCGGCATCGCTGGCGTATCCGCTGACCTAT
CTGATGCGTACCGATGTCGGCAAGGGGCCGCTCGAACTGCTGGCGTTGCGCGGGTTCGCATTGCCTTCAC
GCGTCTTTGTGCCCCGAACGACGCCGTCCCGAGCGGCCGGTACGGCGTTGCAGCCGCCGCCGCTTCCGCC
GGGCGCGCTCGCCGCGGCGCGCCACGCGTCCGTGCCGATCCCCGGCGGGGCGCTGCCCGAATGA
 Primer design