SecReT6
Protein ID: 387904829
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4078
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1245540..1247354 [+]
Producthypothetical protein
NoteTssF
UniProt IDI2DUW0
KEGG IDbuk:MYA_4078
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-180, Aligned region: 11..602
Protein Sequence: 604 a.a.     [Download]
>gi|387904829|ref|YP_006335167.1| hypothetical protein MYA_4078 [Burkholderia sp. KJ006]
MTNPIKDNEILRYYEAEMRYLRDAGREFADAFPDRARELGLDRGGERDPHVERLLEGFAFLMGRLRHKLD
DELPELTEGLVSMLWPHYLRMIPSLSILELTPGMGALQKHETLGAGLEVTSGPIATGHTEGAPAHVECVY
RTTQPIDLYPITLTDAGAWAREDGRSVIRLRLAIQPQAQRERLHVPRLRLYLDADRPIALALHAALTAKP
LAMHVRVPGFPEDRPGAPQDMPGLRIEAAGYAGNERLWPKADNAFGGYQLLLEYFTFPEKFMFVDLLGLD
IQALPPSAPHVDVEIVLAKPWQDDMRFNAQNVRLYCTPIINLFPVQADPVKVTQFETEYRVRAREQHGPL
VDIYSIDAVHGIDRGRRFEYAPFAAFRHRGGMLRHTMPERYFHSHVRRAPSGRFDTWVVLGGHAWESEHA
LPAETLSLSVTGTNGMLPRKALRDASITRMRAGFTNIAAVRNLTAPTLPVYPPTGDRFQWRVLSHLAPNY
LSLLDAEILRGSLALYDWTDGELNRRRIEAIADVRHRPLQKLVKGGLMRGVEIAVTIDSTRFAGNGDLEL
FGAMLNRFLGLYATVNLYTKLVIVSQPTGQRLEWPDTKGEGAPF
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1245540-1247354 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGACGAATCCGATCAAGGATAACGAGATCCTGCGCTATTACGAGGCGGAGATGCGCTATTTGCGCGACG
CCGGCCGGGAGTTTGCCGATGCATTTCCCGATCGCGCGCGCGAGCTGGGCCTGGATCGCGGAGGCGAGCG
CGACCCTCATGTGGAGCGGCTGCTCGAAGGCTTCGCGTTCCTGATGGGCCGCCTGCGTCACAAGCTCGAC
GACGAGCTGCCCGAGTTGACCGAAGGGCTCGTCAGCATGCTGTGGCCGCACTATCTGCGCATGATTCCGT
CGTTGTCGATCCTCGAGCTCACGCCGGGCATGGGTGCGCTGCAAAAGCACGAGACGCTCGGCGCCGGCCT
CGAGGTGACGTCCGGACCGATCGCGACGGGCCACACAGAGGGCGCACCCGCACACGTCGAATGCGTGTAC
CGCACGACGCAGCCGATCGATCTCTACCCGATCACGCTCACCGACGCAGGCGCGTGGGCGCGCGAAGACG
GTCGCTCGGTCATCCGGTTGCGCCTGGCGATTCAGCCACAAGCTCAGCGTGAACGACTGCATGTACCGCG
ACTGCGGCTGTATCTCGACGCGGACCGCCCGATTGCGCTTGCACTGCATGCCGCGTTGACGGCGAAACCG
CTGGCAATGCACGTGCGTGTGCCCGGTTTCCCGGAAGATCGCCCCGGTGCGCCTCAAGATATGCCGGGGC
TTCGGATCGAGGCGGCCGGCTACGCGGGCAACGAACGTCTGTGGCCGAAGGCCGACAACGCGTTTGGCGG
CTACCAGTTGCTGCTGGAGTACTTCACGTTCCCCGAGAAGTTCATGTTCGTCGACCTGCTCGGGCTCGAC
ATCCAGGCGCTTCCACCGTCCGCGCCGCATGTCGACGTCGAGATCGTGCTGGCAAAGCCGTGGCAGGACG
ACATGCGTTTCAACGCGCAGAACGTGCGGCTCTACTGCACGCCGATCATCAACCTGTTTCCCGTTCAGGC
CGATCCGGTCAAGGTCACTCAGTTCGAGACCGAGTACCGGGTACGGGCGCGCGAGCAGCACGGCCCGTTG
GTCGATATCTACTCGATCGACGCGGTGCACGGCATCGATCGCGGCCGACGCTTCGAATATGCGCCGTTCG
CGGCATTCCGCCATCGTGGCGGCATGCTGCGCCATACGATGCCCGAGCGATATTTCCATTCGCACGTGCG
ACGCGCGCCTTCCGGACGGTTCGATACGTGGGTCGTGCTGGGCGGCCACGCTTGGGAAAGCGAGCATGCG
CTGCCCGCGGAAACGCTGTCGCTGTCGGTGACGGGCACCAACGGCATGCTGCCGCGCAAGGCGCTGCGCG
ATGCCAGCATCACGCGGATGCGCGCGGGCTTCACCAACATCGCGGCAGTGCGTAATCTGACCGCACCGAC
GCTGCCGGTCTACCCGCCGACCGGCGATCGCTTCCAATGGCGTGTGCTGTCCCATCTGGCGCCGAACTAT
CTGTCGCTGCTCGATGCGGAAATCCTGCGCGGCTCGCTCGCGTTGTACGACTGGACGGACGGGGAGTTGA
ACCGGCGGCGCATCGAGGCGATCGCCGACGTGCGTCACCGGCCATTGCAGAAGCTCGTGAAGGGCGGCTT
GATGCGCGGCGTCGAGATTGCGGTGACGATCGACAGCACGCGTTTCGCGGGCAACGGCGATCTCGAGCTG
TTCGGCGCCATGCTGAACCGGTTCCTCGGCCTCTATGCGACGGTCAACCTGTACACGAAGCTCGTCATCG
TGTCGCAGCCGACTGGTCAGCGGCTCGAATGGCCCGATACGAAGGGCGAAGGAGCGCCGTTTTGA
 Primer design