SecReT6
Protein ID: 387904830
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4079
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1247420..1248433 [+]
Producthypothetical protein
NoteTssG
UniProt IDI2DUW1
KEGG IDbuk:MYA_4079
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-83, Aligned region: 7..311
Protein Sequence: 337 a.a.     [Download]
>gi|387904830|ref|YP_006335168.1| hypothetical protein MYA_4079 [Burkholderia sp. KJ006]
MLPALLDQAHRMNFYRFCALIELASPDAAPLGATDSPATDPVRFRSRGQLGFPAREIDAVEYDADDPAKP
VAVRTTFLGLYGVDARMPAYFVDEVAQNRDGAEPLAAFLDLFHHRIATQFYRIWRKYRYPAGFRPDGFDT
VSRGALSLVGLGFRSPETRAPDWGLPRDVGARALLSMLGLAAQKTRTAEGLAGVLTHAIPDAAIDVEEFY
PVWRTVNDFEPAALGEQCLLGRGFYDRANTVRIVITPHTREAVAALVPGQPAYRQITALLRFYLGYESEA
LLEMQVHPDLMPEPLLAAGQANLGLTTQLGSPPAVGHGPTRVTRVQLGRWSGATETV
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1247420-1248433 Burkholderia sp. KJ006 chromosome 2, complete sequence
TTGTTGCCGGCGCTGTTGGATCAGGCGCATCGGATGAATTTCTATCGCTTCTGCGCGTTGATCGAACTGG
CGTCACCCGATGCAGCGCCGCTCGGCGCCACCGATTCGCCCGCGACGGATCCGGTCCGGTTCCGCTCGCG
TGGCCAACTTGGGTTTCCGGCGCGCGAGATCGATGCAGTCGAATACGACGCGGACGATCCTGCGAAGCCG
GTTGCGGTGCGTACGACGTTCCTTGGTTTGTACGGCGTCGACGCGCGGATGCCGGCGTACTTCGTCGACG
AAGTGGCGCAGAACCGCGACGGCGCCGAGCCGCTTGCAGCGTTCCTTGATCTGTTTCATCACCGGATCGC
GACGCAGTTCTACCGGATCTGGCGGAAGTACCGCTATCCGGCCGGCTTTCGGCCCGACGGCTTCGATACG
GTGTCGCGCGGCGCGCTCAGTCTCGTCGGACTGGGGTTCCGCTCGCCTGAAACGCGCGCGCCGGACTGGG
GGCTGCCGCGCGACGTCGGCGCGCGCGCACTGCTGTCGATGCTCGGGCTGGCCGCGCAGAAAACGCGTAC
CGCGGAAGGGCTCGCCGGCGTGCTGACACATGCGATACCGGATGCCGCGATCGACGTCGAGGAGTTCTAT
CCGGTGTGGCGTACCGTCAACGATTTCGAGCCTGCAGCGCTCGGCGAACAATGTCTGCTCGGACGCGGGT
TCTACGATCGGGCGAACACGGTGCGCATCGTGATCACGCCGCACACGCGCGAAGCGGTCGCCGCGCTGGT
GCCCGGGCAACCGGCATACCGGCAGATCACCGCGTTGCTGCGCTTCTACCTCGGCTACGAAAGCGAAGCG
CTGCTCGAGATGCAGGTGCATCCCGACCTGATGCCGGAACCGTTGTTGGCCGCCGGTCAGGCGAACCTCG
GCCTGACCACGCAGCTCGGGTCGCCGCCTGCGGTAGGGCACGGACCCACTCGCGTGACACGGGTGCAGCT
GGGGCGCTGGAGCGGGGCGACGGAAACCGTATAA
 Primer design