SecReT6
Protein ID: 387904831
SecReT6 ID659
T6SS typeN/A
Gene symbol-
Locus tagMYA_4080
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1248480..1249121 [+]
Producthypothetical protein
NoteTssJ
UniProt IDI2DUW2
KEGG IDbuk:MYA_4080
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.50E-41, Aligned region: 27..176
Protein Sequence: 213 a.a.     [Download]
>gi|387904831|ref|YP_006335169.1| hypothetical protein MYA_4080 [Burkholderia sp. KJ006]
MDNNQMNILRIPIGRSLAGAVATVVVVATAGCGVGQAVKDSTVDAAKWAFTTQVKTMNLDLVARSSLNAN
AAGQPLSTVVRLYQLKDAKTFEQLDYTQLQTNDLDVLKADLLATKDVVLRPGASASVVEPMNPDAQVVGV
VAFFREPGDGAVWKLAVSKKQWKKTDPVKIEVRDNTLVLVDAKDRPIVRSAPQQSAPAPKPKASVQPGTQ
DEG
 
Nucleotide Sequence: 642 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1248480-1249121 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGGACAACAATCAGATGAACATTTTAAGGATACCGATTGGACGAAGCCTGGCCGGTGCAGTGGCCACCG
TGGTGGTCGTTGCGACCGCCGGTTGCGGCGTCGGCCAGGCCGTGAAGGACAGCACGGTGGACGCTGCGAA
ATGGGCCTTCACGACGCAGGTGAAGACGATGAACCTGGACCTCGTCGCCCGCTCGTCGCTCAATGCCAAC
GCAGCGGGGCAGCCGTTGTCGACGGTGGTGAGGCTCTATCAGTTGAAGGACGCGAAGACCTTCGAGCAAC
TCGACTATACCCAGTTGCAGACCAACGATCTCGATGTGCTGAAGGCGGATCTGCTGGCGACCAAGGATGT
CGTGTTGCGCCCGGGCGCGAGCGCCAGCGTGGTCGAGCCGATGAACCCGGACGCGCAGGTGGTCGGCGTC
GTGGCGTTCTTCCGTGAGCCGGGGGACGGCGCGGTGTGGAAACTGGCGGTGTCGAAGAAGCAGTGGAAAA
AGACCGATCCGGTGAAGATCGAGGTGCGCGACAACACGCTTGTGCTGGTCGACGCGAAGGATCGGCCGAT
CGTGCGATCGGCGCCGCAGCAGAGCGCGCCGGCGCCGAAGCCGAAAGCGTCGGTGCAGCCCGGTACGCAG
GATGAGGGTTGA
 Primer design