SecReT6
Protein ID: 387905458
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4713
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1951861..1952511 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDI2DWN9
KEGG IDbuk:MYA_4713
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.10E-41, Aligned region: 27..176
Protein Sequence: 216 a.a.     [Download]
>gi|387905458|ref|YP_006335796.1| type VI secretion lipoprotein/VasD [Burkholderia sp. KJ006]
MDNNQMSILRIPIGRSFVGAVATVVVVATAGCGVGQAVKDSTVDAAKWAFTTQVKTMNLDLVARSSLNAN
AAGQPLSTVVRLYQLKDAKTFEQLDYTQLQTNDLEALKADLLATKDVVLRPGASASVVEPMNPDAQVVGV
VAFFREPGDGAVWKLAVPKKQWKKTDPVKIEVRDNTLNLVGTKDRPITHTAPQQSAPAAPKPIPKATTQS
GTQDEG
 
Nucleotide Sequence: 651 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1952511-1951861 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGGACAACAATCAGATGAGCATTTTAAGGATACCGATTGGACGAAGCTTCGTCGGTGCAGTGGCCACCG
TGGTGGTCGTTGCGACGGCCGGTTGCGGCGTCGGCCAGGCCGTGAAGGACAGCACGGTGGACGCTGCGAA
ATGGGCCTTCACGACGCAGGTGAAGACGATGAACCTGGACCTCGTCGCCCGCTCATCGCTCAACGCCAAC
GCGGCCGGGCAGCCGTTGTCGACGGTGGTGAGGCTCTATCAGTTGAAGGACGCGAAGACCTTCGAGCAAC
TCGACTATACCCAGTTGCAGACCAACGATCTCGAGGCGCTGAAGGCGGATCTGCTCGCGACCAAGGACGT
CGTGCTGCGCCCGGGCGCGAGCGCCAGCGTGGTCGAGCCGATGAACCCGGACGCACAGGTGGTCGGCGTC
GTGGCGTTCTTCCGTGAGCCGGGGGACGGCGCGGTGTGGAAACTGGCGGTGCCGAAGAAGCAGTGGAAAA
AGACCGATCCGGTGAAGATCGAGGTGCGCGACAACACGCTCAATCTGGTCGGTACAAAGGATCGGCCGAT
AACTCACACCGCGCCCCAGCAGAGCGCACCGGCCGCGCCCAAGCCCATACCTAAAGCAACCACTCAATCC
GGCACACAGGATGAAGGATGA
 Primer design