SecReT6
Protein ID: 387905459
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4714
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1952558..1953574 [-]
Producttype VI secretion protein ImpH/VasB
NoteTssG
UniProt IDI2DWP0
KEGG IDbuk:MYA_4714
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.50E-83, Aligned region: 8..312
Protein Sequence: 338 a.a.     [Download]
>gi|387905459|ref|YP_006335797.1| type VI secretion protein ImpH/VasB [Burkholderia sp. KJ006]
MLLPALLDQAHRMNFYRFCALIELASPDAAPLGATDSPATDPVRFRSRGQLGFPAREIDAVEYDADDPAK
PVAVRTTFLGLYGVDARMPTYFVDEVAQNRDGAEPLSAFLDLFHHRIATQFYRIWRKYRYPAGFRPDGFD
TVSRGVLSFVGLGFRSPDTHAPDWGLPQGVGARTLLSMLGLAAQKTRTAEGLAGVLTHAIPDAAIDVEEF
YPVWRTVNDFEPAALGEQCLLGRGFYDRANTVRIVITPHTRESVTALVPGQPAYRQITALLRFYLGYESE
ALLEMQVHPDLMPEPLLAAGQANLGLTTQLGSPPAVGRGPTRVTRVQLGRWSGATETV
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1953574-1952558 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGTTGTTGCCGGCGCTGTTGGATCAGGCGCATCGGATGAATTTCTATCGCTTCTGCGCGTTGATCGAAC
TGGCGTCACCCGATGCAGCGCCGCTCGGCGCCACCGATTCGCCCGCGACGGATCCGGTCCGGTTCCGCTC
ACGTGGCCAACTTGGGTTTCCGGCGCGCGAGATCGATGCAGTCGAATACGACGCGGACGATCCGGCGAAG
CCGGTTGCGGTGCGTACGACGTTCCTCGGTCTGTACGGCGTCGACGCGCGGATGCCGACGTACTTCGTCG
ACGAAGTGGCGCAGAACCGCGACGGCGCCGAGCCGCTGTCGGCGTTCCTGGACCTGTTCCACCATCGTAT
TGCGACGCAGTTCTACCGGATTTGGCGCAAGTATCGCTATCCGGCCGGTTTCCGGCCGGATGGCTTCGAC
ACGGTCTCCCGCGGTGTGCTCAGCTTTGTCGGTCTTGGGTTCCGGTCGCCGGACACACATGCGCCTGACT
GGGGGCTGCCGCAGGGCGTTGGTGCGCGAACGCTGCTGTCGATGCTCGGACTAGCCGCTCAGAAGACGCG
TACCGCGGAAGGGCTCGCCGGCGTGCTGACACATGCGATACCGGATGCCGCGATCGACGTCGAGGAGTTC
TATCCGGTGTGGCGTACCGTCAACGATTTCGAGCCTGCAGCGCTCGGCGAACAATGTCTGCTCGGACGCG
GATTCTACGATCGGGCGAACACGGTACGCATCGTGATCACGCCGCACACGCGCGAATCGGTCACCGCGCT
GGTGCCCGGGCAACCGGCATACCGACAGATCACCGCGTTGCTGCGCTTCTACCTCGGCTACGAAAGCGAA
GCGCTGCTCGAGATGCAGGTGCATCCTGACCTGATGCCGGAACCGTTGTTGGCCGCCGGTCAGGCGAACC
TCGGCCTGACCACGCAGCTCGGGTCGCCGCCTGCGGTAGGGCGCGGACCCACTCGCGTGACACGGGTGCA
GTTGGGGCGCTGGAGCGGGGCGACGGAAACCGTATAA
 Primer design