SecReT6
Protein ID: 387905460
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4715
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1953637..1955451 [-]
Producttype VI secretion protein ImpG/VasA
NoteTssF
UniProt IDI2DWP1
KEGG IDbuk:MYA_4715
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.40E-181, Aligned region: 11..602
Protein Sequence: 604 a.a.     [Download]
>gi|387905460|ref|YP_006335798.1| type VI secretion protein ImpG/VasA [Burkholderia sp. KJ006]
MTNPIKDNEILRYYEAEMRYLRDAGREFADAFPDRARELGLDRGGERDPHVERLLEGFAFLMGRLRHKLD
DELPELTEGLVSMLWPHYLRMIPSLSILELTPDMGALQKHETLGAGLEVTSGPIATGHTDGAPAHVECVY
RTTQPIDLYPITLTDAGAWAREDGRSVIRLRLAIQPQAQRERLHVPRLRLYLDADRPIALALHAALTAKP
LAMHVRVPGFPEDRPGAPQDMPGLRIEAAGYAGNERLWPKADNAFGGYQLLLEYFTFPEKFMFVDLLGLD
IQALPPSAPHVDVEIVLAKPWQDDMRFNAQNVRLYCTPIINLFPVQADPVKVTQFETEYRVRAREQHGPL
VDIYSIDAVHGIDRGRRFEYAPFAAFRHRGGMLRHTMPERYFHSHVRRAPSGRFDTWVVLGGHAWESEHA
LPAETLSLSVTGTNGMLPRKALRDASITRMRAGFTNIAAVRNLTAPTLPVYPPTGDRFQWRVLSHLAPNY
LSLLDAEILRGSLALYDWTDGELNRRRIEAITDVRHRPLQKLVKGGLMRGVEIAVTIDSTRFAGNGDLEL
FGAMLNRFLGLYATVNLYTKLVIVSQPTGQRLEWPDTKGEGAPF
 
Nucleotide Sequence: 1815 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1955451-1953637 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGACGAATCCGATCAAGGATAACGAGATCCTGCGCTATTACGAGGCGGAGATGCGCTATTTGCGCGACG
CCGGCCGGGAGTTTGCCGATGCATTTCCCGATCGCGCGCGCGAGCTGGGCCTGGATCGCGGAGGCGAGCG
CGACCCTCATGTGGAACGGCTGCTCGAAGGCTTCGCGTTCCTGATGGGCCGCCTGCGTCACAAGCTCGAC
GACGAGCTGCCCGAGCTGACCGAAGGGCTCGTCAGCATGCTGTGGCCGCACTATCTGCGCATGATTCCGT
CGCTGTCGATCCTCGAGCTCACGCCGGACATGGGTGCGCTGCAAAAGCACGAGACGCTCGGCGCCGGCCT
CGAGGTGACGTCCGGACCGATCGCGACGGGCCACACAGACGGCGCACCCGCACACGTCGAATGCGTGTAC
CGCACGACGCAGCCGATCGATCTCTACCCGATCACGCTCACCGACGCAGGCGCGTGGGCGCGCGAAGACG
GCCGCTCGGTCATCCGGTTGCGCCTGGCGATTCAGCCGCAAGCTCAGCGTGAACGACTGCATGTACCGCG
ACTGCGGCTGTATCTCGACGCGGACCGGCCGATTGCGCTCGCACTGCATGCCGCGTTGACGGCGAAACCG
CTGGCAATGCACGTGCGTGTGCCCGGTTTCCCGGAAGATCGCCCCGGTGCGCCTCAAGATATGCCGGGGC
TTCGGATCGAGGCGGCCGGCTACGCGGGCAACGAACGTCTGTGGCCGAAGGCCGACAACGCGTTTGGCGG
CTACCAGTTGCTGCTGGAGTACTTCACGTTCCCCGAGAAGTTCATGTTCGTCGACCTGCTCGGGCTCGAC
ATCCAGGCGCTTCCACCGTCCGCGCCGCATGTCGACGTCGAGATCGTGCTGGCAAAGCCGTGGCAGGACG
ACATGCGTTTCAACGCGCAGAACGTGCGGCTCTACTGCACGCCGATCATCAACCTGTTTCCCGTTCAGGC
CGATCCGGTCAAGGTCACTCAGTTCGAGACCGAGTACCGGGTACGGGCGCGCGAGCAGCACGGCCCGTTG
GTCGATATCTACTCGATCGACGCGGTGCACGGCATCGATCGCGGCCGACGCTTCGAATATGCGCCGTTCG
CGGCATTCCGCCATCGTGGCGGCATGCTGCGCCATACGATGCCCGAGCGATATTTCCATTCGCACGTGCG
ACGCGCGCCTTCCGGACGGTTCGATACGTGGGTCGTGCTGGGCGGCCACGCTTGGGAAAGCGAGCATGCG
CTGCCCGCGGAAACGCTGTCGCTGTCGGTGACGGGCACCAACGGCATGCTGCCGCGCAAGGCGCTGCGCG
ATGCCAGCATCACGCGGATGCGCGCGGGCTTCACCAACATCGCGGCAGTGCGCAATCTGACCGCACCGAC
GCTGCCGGTCTACCCGCCGACCGGCGATCGCTTCCAATGGCGTGTGCTGTCCCATCTGGCGCCGAACTAT
CTGTCGCTGCTCGATGCGGAAATCCTGCGCGGCTCGCTCGCGTTGTACGACTGGACGGACGGGGAGTTGA
ACCGGCGTCGCATCGAGGCGATCACCGACGTGCGTCACCGGCCATTGCAGAAGCTCGTGAAGGGCGGCCT
GATGCGCGGCGTCGAGATTGCGGTGACGATCGACAGCACACGTTTCGCGGGCAACGGCGATCTCGAGCTG
TTCGGCGCCATGCTGAACCGGTTCCTCGGCCTCTATGCGACGGTCAACCTGTACACGAAGCTCGTCATCG
TGTCGCAGCCGACCGGTCAGCGGCTCGAATGGCCCGATACGAAGGGCGAAGGAGCGCCGTTTTGA
 Primer design