SecReT6
Protein ID: 387905461
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4716
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1955468..1958524 [-]
Producthypothetical protein
NoteTssM
UniProt IDI2DWP2
KEGG IDbuk:MYA_4716
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.50E-72, Aligned region: 240..558
DUF1215 [PF06744], Evalue: 1.20E-36, Aligned region: 681..806
Protein Sequence: 1018 a.a.     [Download]
>gi|387905461|ref|YP_006335799.1| hypothetical protein MYA_4716 [Burkholderia sp. KJ006]
MTQIRRHRTARPIDAIVLVLDESTILPDSVRGTSSPWGLHLARISNLLRWAAPVFVLDLAGSDAVHRADT
PVNGCELSRASDASAVETALLELRNRLADVSVGQLAHNPADRYASDLSTRLDTRSAPLARWIASLSDWQR
RAQPVAGVMFAPWPASGATTTGTDSLHFPLWRYLTDAAKRTPGRRTATHPLTMVSGIALAAVGLWGAGML
ISGLTNARGLALTNDVLRTFNGANSPATRLRALLALQQRIEFYEARVERPTLFSRFGLNHDQDVLTALWK
PYVREARPQLLAPVQQDIEGQLVDLTQMPTAQVDDQVNRLARDGHATLKTYLMMADPSRADAAFMTPQLV
RHWNGGIGLSPGEKLDLSQRLLAFYAQHLGAHPDWRIAARDELVAGARQTLLAVIGVKNSEDMIYQGILE
SVGRKYPDQTLASLTDGTDTRGLLKTTASVPGAYTRQAWDGTIEAAIDDMAKRNGVTADWVLGATSANRN
ASAATPEALRASLRTRYFADYADRWQTFMNSITCEPARTLPAAVAQLKLIADSRQSPVISLMKSLEFQGG
AGVVKTSLSDTLVNKAQNMFASKDNAPQPAAPDPAGPLGVSFGPVLHLIAPGNAATAGATSDLSLQRFIE
RITMLRLKLQQIADSPDADSESRQVAQSLFQGKSSELADTLAYAQLVAASLGEQWAGMGQSLFVQPVTQA
TQAILEPAQASLNDAWRQTVVASWNRSFAGRYPFANTNNDASLPELSRFLRPQGGLVGVFLATQLAGVLT
LQGDQWVPASSGSGASSAARTIDPAFLNAINMLQRIANHLLAQGEPQYAFDLKPVPSLGVTDTRLTVDGQ
KLHYYNQQETWQTFTWPSNEPQKAGTRLEWQTERAGTNLNMEFGGRWALVRLLERAHVSPVDTATYLITW
QAAPQAPQSKAGVAKTDDGESLTTQAPLAPAPASLAYPLTYLMRTDVGKGPLELLALRGFALPSRVFVPR
TTPSRAAGTALQPPPLPPGALAAARHASVPIPGGSLPE
 
Nucleotide Sequence: 3057 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1958524-1955468 Burkholderia sp. KJ006 chromosome 2, complete sequence
TTGACGCAGATCCGCCGCCATCGCACCGCCCGCCCCATCGATGCAATCGTGCTGGTACTCGACGAATCGA
CGATTCTGCCCGACTCGGTCCGAGGCACGAGCAGCCCCTGGGGCCTCCACCTCGCGCGCATCAGCAACTT
GCTGAGGTGGGCCGCGCCAGTATTTGTGCTCGACCTTGCGGGTTCGGATGCCGTTCATCGTGCGGACACT
CCCGTGAATGGCTGCGAGCTTTCACGAGCGAGCGATGCATCCGCCGTCGAAACCGCGCTACTCGAATTAC
GCAATCGATTGGCCGACGTCAGTGTCGGCCAGCTCGCGCACAACCCTGCCGACCGCTACGCGTCAGATCT
CTCGACCCGTCTCGATACGCGTAGCGCACCGCTGGCTCGCTGGATCGCGAGTTTGTCCGACTGGCAACGT
CGTGCCCAACCGGTTGCCGGTGTGATGTTCGCACCGTGGCCGGCATCCGGAGCGACGACAACGGGCACCG
ACAGTCTTCACTTTCCGTTGTGGCGCTATCTGACCGATGCAGCCAAGCGTACGCCGGGCCGCCGTACGGC
GACGCATCCTCTCACGATGGTCTCGGGAATCGCGCTGGCGGCCGTCGGACTGTGGGGCGCCGGCATGCTC
ATCTCGGGCCTGACGAATGCCCGCGGCCTGGCGCTGACGAATGACGTGCTTCGCACGTTCAATGGCGCCA
ACAGTCCGGCGACCCGTCTGCGCGCCTTGCTCGCGCTCCAGCAGCGCATCGAGTTCTACGAAGCGCGCGT
CGAGCGTCCGACGCTGTTCTCGCGCTTCGGCCTGAATCACGATCAGGACGTGCTCACCGCGTTATGGAAG
CCCTATGTGCGCGAAGCGCGCCCGCAACTGCTTGCGCCCGTGCAACAGGACATCGAAGGGCAACTGGTCG
ATCTCACGCAGATGCCGACCGCCCAAGTCGATGACCAGGTCAATCGCCTCGCTCGCGACGGTCACGCCAC
GCTCAAGACGTACCTGATGATGGCGGACCCGTCGCGCGCCGATGCGGCGTTCATGACGCCGCAACTGGTG
CGCCATTGGAACGGCGGCATCGGACTGTCTCCGGGCGAAAAGCTCGACCTGTCGCAGCGGCTGCTGGCGT
TCTACGCGCAGCACCTCGGCGCGCATCCCGACTGGCGCATCGCCGCGCGTGACGAGCTCGTCGCGGGCGC
CCGCCAGACCTTGCTCGCCGTGATCGGCGTGAAAAACTCGGAAGACATGATCTATCAGGGCATCCTCGAA
TCGGTCGGTCGCAAGTACCCGGACCAGACGCTCGCGTCTCTGACCGATGGCACCGACACGCGCGGACTGC
TGAAAACCACGGCCAGCGTGCCCGGCGCGTACACGCGTCAGGCATGGGACGGGACCATCGAGGCCGCGAT
CGACGACATGGCGAAACGCAATGGCGTGACGGCCGACTGGGTGCTCGGCGCGACCAGCGCCAATCGCAAC
GCGTCGGCCGCGACGCCCGAGGCGCTGCGCGCGTCGTTGCGCACGCGCTACTTCGCGGACTATGCGGACC
GTTGGCAAACCTTCATGAACAGCATCACGTGCGAACCGGCGCGGACCTTGCCGGCCGCCGTCGCGCAGTT
GAAACTCATCGCCGATTCGCGGCAGTCGCCGGTGATCTCGCTGATGAAGTCGCTCGAGTTCCAGGGCGGA
GCGGGCGTCGTGAAGACATCGCTGTCCGACACCCTGGTGAACAAGGCGCAGAACATGTTCGCGAGCAAGG
ACAATGCGCCGCAGCCGGCCGCGCCCGACCCGGCCGGACCGCTCGGCGTGTCGTTCGGCCCCGTGTTGCA
TCTGATCGCACCGGGGAACGCTGCGACGGCAGGCGCAACGAGCGACCTGAGCCTGCAGCGTTTCATCGAA
CGCATCACGATGCTGCGTCTGAAGCTGCAACAAATCGCTGACAGCCCGGACGCCGATAGCGAGTCGCGAC
AAGTCGCGCAGTCGCTGTTCCAAGGCAAGAGTTCGGAACTGGCCGACACGCTCGCCTATGCGCAGCTTGT
CGCCGCCAGTCTCGGCGAGCAGTGGGCGGGGATGGGGCAGTCGCTGTTCGTGCAGCCGGTCACGCAAGCC
ACTCAGGCCATTCTGGAGCCGGCACAGGCGAGCTTGAACGACGCATGGCGCCAGACCGTCGTCGCGAGCT
GGAACCGCTCGTTTGCCGGCCGCTATCCGTTCGCCAACACCAACAACGACGCATCGTTGCCGGAGCTGTC
GCGCTTCCTGCGACCGCAGGGCGGCTTGGTCGGCGTGTTCCTCGCCACGCAGCTGGCGGGCGTGCTGACG
TTGCAGGGCGACCAATGGGTGCCGGCATCGAGCGGTTCGGGCGCGAGCAGCGCGGCGCGCACGATCGATC
CGGCCTTTCTCAATGCGATCAACATGCTGCAGCGGATCGCCAATCACCTGCTGGCGCAGGGCGAGCCGCA
GTACGCATTCGACCTCAAACCGGTACCCAGCCTCGGCGTGACGGACACGCGCCTAACGGTAGACGGTCAA
AAGCTGCACTACTACAACCAGCAGGAGACGTGGCAGACGTTCACGTGGCCGTCGAACGAGCCGCAGAAGG
CGGGCACGCGTCTCGAATGGCAGACCGAGCGAGCGGGCACGAACCTGAACATGGAATTCGGCGGCCGGTG
GGCGCTGGTCCGGCTGCTGGAGCGAGCACACGTGAGCCCGGTGGATACGGCCACCTATCTGATCACTTGG
CAGGCCGCGCCGCAGGCGCCGCAGTCGAAGGCAGGCGTCGCGAAGACGGACGATGGCGAGTCGTTGACCA
CGCAGGCGCCGCTCGCTCCCGCGCCGGCATCGCTGGCGTATCCGCTCACCTACCTGATGCGCACCGATGT
GGGCAAGGGGCCGCTCGAACTGCTGGCGTTGCGCGGGTTCGCATTGCCTTCACGCGTCTTTGTGCCCCGA
ACGACGCCGTCCCGAGCGGCCGGTACGGCGTTGCAGCCGCCGCCGCTTCCGCCGGGCGCACTCGCCGCGG
CGCGCCACGCATCCGTGCCGATCCCCGGCGGGTCTCTGCCCGAATGA
 Primer design