SecReT6
Protein ID: 387905464
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4719
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1963582..1965897 [-]
ProductVgrG protein
NoteTssI
UniProt IDI2DWP5
KEGG IDbuk:MYA_4719
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 3.10E-41, Aligned region: 543..695
Phage_GPD [PF05954], Evalue: 2.30E-40, Aligned region: 16..289
Phage_GPD [PF05954], Evalue: 2.30E-40, Aligned region: 512..545
T6SS_Vgr [PF13296], Evalue: 3.50E-36, Aligned region: 422..528
Phage_base_V [PF04717], Evalue: 8.10E-08, Aligned region: 320..413
Protein Sequence: 771 a.a.     [Download]
>gi|387905464|ref|YP_006335802.1| VgrG protein [Burkholderia sp. KJ006]
MLTHPLQLTRIDYLNRDAVCTIVPDDGVPHRFSGFIARFSTLQTTADFTKYEIVLKSHFARLEAVSTSRI
YQHQTTPQIIEAVLRSHGLEGHQFAFRLRREYPKHLFRFQYKLDDLSYVRMLMQKAGIYSYIVETEHGDQ
AVFADDVDHYQWDPHLTAAYRETAGLEATGAEAVTALKTHTVTVPQSFVVADYNPEQAWERFRDDANVAP
QDPTTYGQTYVYGTHHLDQDGAKWEAQLRHEAAIAWQIVYEGESNVLALQAGRVLNLDTVLPDAPDGQVV
IEVTHSGARDRAYSNSYIAIPANRRFRLQLEDAKWPKIAGTLSARVTSPDKYKYAYLTGAGYYTVRFDVD
FADWPAGGESVPLRLAKPFAGKLQTGFHFPALDNDEAVIAFRDADPDKPEIIGFHHHSQARDLVTSDRRW
LSRNVIRTQSNNKLRMEDWAGQEGVKLSTEHSGTSHLDLGYLVNQRLEYRGEGFELRTSGYGAIRAGKGL
LVSADDQPDAEGKQLDMKAASTQLKEALQLMRSLEKAARSAQAQVNAVEQQRQLLAERLDRLQRAVLLAT
APEGVAVTSGDHLQLSAKTNLTATAIENADIGAGKNVSLSAANAVSIFAQNEGVKVVAAKNDIQAIAHSG
QVLMTSAKDMKLVSVEGELHAFSRNAVVISSGGAYIKLSGGNIELGCPGSIIFKRAGTFAQGPASLHESY
PPLANSGPNSRKFVLHYDGHPDDVIKGQRYRIHKENGAVIEGVSNDSGETSVAQSEIAEVVRIELLGKDK
S
 
Nucleotide Sequence: 2316 bp     [Download]
>gi|387903680|ref|NC_017921.1|:c1965897-1963582 Burkholderia sp. KJ006 chromosome 2, complete sequence
GTGCTCACGCATCCGCTGCAACTCACGCGTATCGACTACCTGAATCGCGACGCGGTCTGCACGATCGTGC
CTGACGATGGTGTGCCACATCGTTTCTCCGGTTTTATCGCGCGCTTCTCGACGCTGCAGACCACCGCGGA
CTTCACCAAGTACGAGATCGTGCTGAAGTCGCACTTCGCGCGACTGGAAGCGGTGAGCACCAGCCGTATC
TACCAGCACCAGACGACGCCGCAGATCATTGAGGCAGTGCTGCGCAGCCATGGCTTGGAAGGCCACCAGT
TCGCATTCCGGCTGCGCCGCGAGTATCCGAAGCACCTGTTCCGCTTTCAGTACAAGCTCGACGACCTGTC
GTATGTGCGGATGCTGATGCAGAAGGCCGGCATCTACAGCTACATCGTCGAGACCGAGCATGGCGATCAG
GCGGTGTTTGCCGACGACGTCGACCATTACCAGTGGGACCCGCACTTGACTGCGGCGTATCGCGAGACTG
CGGGGCTGGAGGCGACCGGCGCCGAGGCGGTGACCGCACTCAAGACGCATACGGTGACCGTGCCGCAGTC
GTTTGTCGTGGCCGATTACAACCCCGAGCAGGCGTGGGAGCGTTTCCGGGACGACGCAAACGTTGCACCG
CAGGATCCGACCACGTACGGCCAGACCTACGTCTACGGCACTCACCATCTCGATCAGGACGGCGCGAAAT
GGGAGGCGCAACTGCGCCATGAAGCGGCGATCGCATGGCAGATCGTGTACGAAGGCGAGAGCAACGTGCT
GGCGCTGCAGGCCGGGCGCGTGCTGAATCTCGACACGGTATTGCCCGATGCACCCGACGGACAGGTGGTG
ATCGAAGTGACGCATAGCGGCGCGCGCGATCGGGCTTACTCGAACAGCTACATCGCAATTCCCGCTAACC
GGCGCTTCCGGCTCCAGCTCGAAGACGCGAAGTGGCCGAAGATTGCCGGGACGCTGAGCGCTCGGGTGAC
GAGCCCCGACAAGTACAAATACGCTTACCTGACCGGGGCAGGCTACTACACGGTTCGATTCGACGTGGAC
TTCGCGGACTGGCCGGCGGGCGGGGAAAGCGTGCCGCTGCGGCTGGCGAAGCCCTTCGCGGGCAAGTTGC
AGACGGGCTTCCACTTCCCGGCGCTGGACAACGATGAAGCGGTGATCGCGTTCCGGGACGCGGACCCCGA
CAAGCCGGAGATCATCGGCTTCCACCATCACAGTCAGGCGCGCGATCTGGTGACGAGCGATCGCCGCTGG
CTGTCGCGCAACGTGATCCGCACGCAGTCGAACAACAAACTGCGGATGGAGGACTGGGCGGGGCAGGAGG
GCGTCAAGCTCAGCACCGAGCATTCGGGAACGAGCCATCTCGATCTTGGCTATCTGGTCAATCAGAGGCT
GGAGTATCGAGGCGAAGGATTTGAGCTTCGCACTTCCGGTTACGGCGCAATCCGGGCGGGCAAAGGCCTG
CTTGTTTCGGCGGACGACCAGCCCGATGCCGAGGGCAAGCAACTCGACATGAAGGCGGCCTCGACGCAGC
TCAAAGAGGCGTTGCAATTGATGCGAAGCCTCGAAAAAGCTGCCCGTTCGGCCCAAGCTCAGGTGAACGC
CGTCGAGCAACAGCGGCAGTTGCTTGCCGAGAGATTGGACCGCCTACAGCGTGCGGTCCTATTGGCGACT
GCGCCGGAAGGTGTAGCCGTCACTAGCGGCGATCACCTTCAGTTGTCCGCGAAGACGAATCTTACGGCAA
CTGCGATCGAAAACGCCGATATTGGTGCGGGGAAAAACGTCTCGTTGTCTGCCGCCAACGCAGTATCGAT
TTTCGCGCAGAACGAAGGGGTCAAGGTCGTAGCTGCGAAAAATGATATTCAGGCCATCGCTCATTCGGGC
CAGGTGCTGATGACGTCCGCGAAAGACATGAAACTCGTCAGCGTCGAAGGAGAGCTCCATGCGTTCTCCC
GTAACGCAGTCGTCATCTCGTCTGGCGGTGCTTATATCAAACTATCGGGCGGCAATATTGAACTGGGGTG
TCCGGGCTCGATCATTTTCAAGCGCGCCGGGACGTTTGCGCAGGGGCCAGCAAGTCTGCACGAATCGTAT
CCGCCGCTCGCCAATTCTGGGCCTAATTCACGCAAATTCGTACTTCATTATGACGGCCATCCTGACGATG
TCATAAAGGGGCAGCGCTACCGCATTCATAAGGAAAACGGGGCGGTGATTGAAGGTGTGAGCAATGACAG
CGGAGAAACGAGCGTTGCGCAAAGCGAGATCGCAGAAGTGGTCAGAATTGAACTGCTCGGTAAGGATAAA
TCGTGA
 Primer design