SecReT6
Protein ID: 387905466
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4721
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1966355..1967677 [+]
Producttype VI secretion protein ImpC/EvpB
NoteTssC
UniProt IDI2DWP7
KEGG IDbuk:MYA_4721
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.30E-167, Aligned region: 14..436
Protein Sequence: 440 a.a.     [Download]
>gi|387905466|ref|YP_006335804.1| type VI secretion protein ImpC/EvpB [Burkholderia sp. KJ006]
MRINTIACIDSDLIDWYLAELDDQLGRQLDAILHHCAFQTLESTWRGLQFLVDRTDFRQNVKIEVLDVSK
EALRQDFEDAPDIIQSGLFRLTYVGEYDMPGGQPIAAIVSAFEFDHGGPDIALLRNISKVAAAAHMPFIG
AVSPAFFGKTTMEAVAGIRDLPSWFERAEYLKWKGFRETEDARYIALTMPRFLARLPYGFDTMPVRAFNY
TENVRESGRSAYLWTSAAFAFAVNIVRSFVRNGWCVQIRGPQAGGVINDIPAHRYDLGAGQLGKISTDAL
ISETRENEFADIGLIPLSYTRNHDQTCFFSAHSTQRPRSYDARDASANSRINARLPYIFLLSRIAHYLKL
IQRENIGTTRDSRLLELELNTWIKSLVTEMTDPGDELQAAHPLRQAKVTVEDIEDNPGFFRIKLFIVPHF
QIEGVDINLSLVSQMPKAKH
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1966355-1967677 Burkholderia sp. KJ006 chromosome 2, complete sequence
ATGCGCATAAATACGATTGCGTGCATCGATTCCGATTTGATCGATTGGTATCTGGCTGAATTGGACGATC
AACTCGGCAGACAGCTCGACGCCATCCTCCACCACTGCGCATTTCAGACACTCGAATCGACGTGGCGCGG
CCTGCAATTCCTGGTGGATCGGACTGATTTTCGACAAAACGTCAAAATCGAGGTGCTTGATGTCTCGAAA
GAAGCGCTGCGTCAAGACTTCGAAGATGCACCGGACATCATCCAGAGTGGCCTGTTCCGGCTGACATACG
TCGGCGAATACGACATGCCGGGCGGGCAGCCCATCGCCGCGATCGTCTCGGCCTTTGAATTCGATCACGG
CGGCCCGGACATCGCACTATTGCGCAATATCTCGAAAGTCGCGGCCGCGGCCCATATGCCGTTCATCGGC
GCCGTCTCGCCTGCGTTCTTCGGGAAAACCACGATGGAAGCCGTCGCAGGCATCCGCGATCTGCCGAGCT
GGTTCGAGCGGGCCGAATACCTGAAGTGGAAAGGCTTCCGTGAAACTGAGGATGCACGCTACATCGCGCT
CACAATGCCGCGATTCCTTGCACGTTTGCCGTACGGATTCGATACGATGCCCGTGCGCGCATTCAATTAC
ACCGAGAATGTCAGGGAATCTGGTCGCAGCGCATATCTGTGGACAAGCGCGGCGTTCGCTTTTGCGGTCA
ATATCGTGCGCAGCTTCGTACGAAACGGTTGGTGTGTGCAGATTCGCGGCCCGCAAGCGGGTGGCGTCAT
CAATGACATTCCCGCGCATCGGTACGACCTCGGCGCCGGGCAACTGGGTAAGATTTCCACGGACGCATTG
ATTTCGGAAACACGCGAGAATGAATTCGCCGATATCGGCCTAATTCCCCTTTCGTATACCCGCAATCACG
ATCAAACGTGTTTCTTCTCGGCGCATTCAACGCAACGGCCGCGATCTTACGATGCACGCGACGCCTCCGC
GAATAGCCGGATCAATGCCCGTTTACCGTACATCTTCTTGCTGTCACGGATCGCACATTACCTGAAGCTC
ATCCAGCGCGAAAACATCGGCACGACGCGCGATAGCCGATTGCTGGAGCTCGAGCTGAATACCTGGATTA
AATCGCTTGTCACGGAAATGACCGATCCCGGCGATGAACTTCAGGCGGCACACCCGCTGCGGCAGGCCAA
GGTCACGGTCGAGGACATCGAGGACAACCCGGGGTTCTTCCGCATCAAGCTGTTCATCGTCCCGCATTTT
CAGATCGAGGGCGTCGACATCAACCTCTCCCTGGTTTCGCAGATGCCGAAAGCGAAACATTGA
 Primer design