SecReT6
Protein ID: 387905467
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4722
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1967674..1969080 [+]
Producttype VI secretion protein ImpJ/VasE
NoteTssK
UniProt IDI2DWP8
KEGG IDbuk:MYA_4722
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.50E-131, Aligned region: 38..465
Protein Sequence: 468 a.a.     [Download]
>gi|387905467|ref|YP_006335805.1| type VI secretion protein ImpJ/VasE [Burkholderia sp. KJ006]
MNAFRRAPLHRYFHSRTTNKMKITRPLWAKGIFMTPQHFQQQAIWEQYVHDRVARIASPDAWGAVHVALD
SEALSVNRLQCTALGLRLPDGTLIDSETADWLPAARSLDDVPTTVDSVTVLAGVALMDAQGGNCVEPGEK
PARPRRVTREYKHVADLNGDGQEEITVERNVVALLFDFEQAGDYVTCPIARLVRTPQGRFEQDKSFVPPC
LFLSASDRLVHRAQRISEILSAKSASLAVRRKERSDQIADFAVSDVALFWLLHSVNSTWPELARLVQAPD
QHPERLYAVLARLAGSLLTFSTTESLQAIPLYDHHAPEPMFAELESLIRTLLDAVIPSRVVPIALERVRA
TTWLGRINDERLTEGAEYYLSVQAAMPAHALIEHLPRLCKVGAPDEVEQIVNSALLGIALRPMSRLPAAI
PVRIENQYFALDSNDAAFKRMIDAHACQIYVPASIPEASLELYAVLPS
 
Nucleotide Sequence: 1407 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1967674-1969080 Burkholderia sp. KJ006 chromosome 2, complete sequence
TTGAACGCGTTCCGTCGCGCACCTCTACACCGCTACTTCCATTCCAGAACAACCAACAAGATGAAGATAA
CCAGACCGCTGTGGGCCAAGGGGATTTTCATGACGCCGCAGCACTTCCAGCAGCAGGCGATATGGGAACA
ATACGTCCATGACCGTGTAGCCCGTATCGCAAGCCCCGACGCTTGGGGTGCCGTCCACGTTGCGCTCGAC
AGCGAAGCACTGAGCGTCAATCGACTGCAGTGCACGGCGCTCGGGCTGCGCCTGCCGGACGGTACGCTGA
TCGATAGTGAAACGGCCGACTGGCTTCCTGCGGCACGCAGTCTCGACGACGTGCCGACAACGGTCGACAG
CGTGACCGTGCTTGCTGGTGTAGCACTGATGGACGCTCAGGGCGGCAACTGCGTCGAACCCGGCGAAAAG
CCTGCGCGGCCGCGGCGCGTGACCCGCGAATACAAGCACGTTGCCGATCTGAACGGCGACGGACAGGAAG
AAATCACCGTCGAGCGCAACGTGGTAGCCCTTCTGTTCGACTTCGAGCAGGCCGGAGACTACGTCACCTG
TCCGATCGCGCGGCTCGTGCGCACGCCACAAGGGCGGTTCGAACAGGACAAGAGCTTCGTCCCGCCGTGC
CTGTTCCTGTCGGCGAGCGATCGCCTCGTGCATCGCGCGCAGCGCATCTCCGAAATCCTGTCTGCCAAGA
GCGCCAGCCTTGCAGTGCGCCGCAAAGAGCGCTCGGATCAGATCGCCGATTTCGCCGTGTCCGACGTGGC
GCTCTTCTGGCTGTTACATAGCGTGAATAGCACCTGGCCCGAACTCGCCCGTCTCGTACAGGCGCCGGAC
CAGCATCCGGAACGGCTCTACGCCGTGCTCGCCCGCTTGGCCGGCTCACTGCTGACGTTCTCTACGACCG
AGTCGCTCCAGGCGATTCCGCTATACGATCACCACGCGCCGGAGCCGATGTTTGCCGAGCTCGAATCGCT
GATCAGAACACTGCTCGACGCCGTGATTCCGTCCCGAGTCGTGCCGATTGCACTCGAGCGCGTGCGCGCG
ACCACATGGCTCGGCCGAATCAACGACGAGCGGCTGACGGAGGGCGCTGAATACTATCTGTCGGTTCAGG
CCGCCATGCCCGCACACGCCCTCATCGAGCACCTGCCGCGCCTCTGCAAGGTCGGCGCACCGGACGAAGT
CGAGCAGATCGTCAATTCCGCGCTGCTCGGCATCGCGCTGCGCCCGATGTCGCGCCTGCCTGCCGCGATT
CCCGTGCGGATAGAAAACCAGTACTTCGCGCTGGACAGCAACGATGCCGCGTTCAAGCGGATGATCGACG
CGCATGCCTGCCAGATCTACGTGCCGGCGTCGATTCCTGAAGCGTCGCTCGAGCTGTATGCGGTGCTGCC
GTCATGA
 Primer design