SecReT6
Protein ID: 387905468
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4723
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1969254..1969739 [+]
Producthypothetical protein
NoteTssL
UniProt IDI2DWP9
KEGG IDbuk:MYA_4723
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.30E-30, Aligned region: 2..150
Protein Sequence: 161 a.a.     [Download]
>gi|387905468|ref|YP_006335806.1| hypothetical protein MYA_4723 [Burkholderia sp. KJ006]
MINDAVYALCALLDEAALKHLTGEARESWEKRPLQEERFSRNDAGEELVRRIEDRLLEPRSPRVLLAIFA
AVLSLGFTGRFAMDGSTARAALIRTLDERLGRTTAAEDNHAAPASIVVNRTNARPLRISPLTWVVASCVA
VGVAWFMVDRWFIASIAQIAQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1969254-1969739 Burkholderia sp. KJ006 chromosome 2, complete sequence
GTGATCAACGATGCGGTCTACGCGCTGTGCGCACTGCTCGACGAGGCCGCATTGAAGCACCTCACGGGAG
AAGCTCGCGAAAGCTGGGAGAAGCGGCCGCTCCAGGAGGAACGTTTCTCGAGAAACGATGCCGGCGAGGA
GTTGGTACGACGCATCGAGGATCGCTTGCTCGAGCCACGGTCGCCGCGGGTGCTGCTTGCGATATTCGCC
GCGGTGCTGTCGCTTGGCTTCACCGGACGGTTTGCGATGGACGGGAGTACAGCGCGTGCGGCGCTTATTC
GCACCCTCGACGAACGACTCGGGCGCACGACCGCAGCGGAGGACAACCACGCAGCGCCTGCTTCGATCGT
GGTGAACCGCACCAACGCCCGCCCGCTGCGCATTTCTCCGCTGACTTGGGTGGTCGCCTCGTGCGTCGCC
GTCGGCGTCGCATGGTTCATGGTCGATCGATGGTTCATCGCGTCGATTGCGCAGATCGCGCAATAA
 Primer design