SecReT6
Protein ID: 387905469
SecReT6 ID660
T6SS typeN/A
Gene symbol-
Locus tagMYA_4724
StrainBurkholderia sp. KJ006
Repliconchromosome II [GenBank: NC_017921] [Browse all T6SS(s) in this replicon]
Location [Strand]1969812..1970183 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDI2DWQ0
KEGG IDbuk:MYA_4724
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.40E-18, Aligned region: 9..94
Protein Sequence: 123 a.a.     [Download]
>gi|387905469|ref|YP_006335807.1| type VI secretion system lysozyme-related protein [Burkholderia sp. KJ006]
MDDFASEVQVFLSVRDNIERILNSRRGSLAHLPDYGLDDLSEIYRHLPSSAHKLRRAIEATLLAYEPRLK
RIEIEIHPPEPGMLISFTMACHLHQAGLVRFGTNFMPDGKTRLRMLQAALDRY
 
Nucleotide Sequence: 372 bp     [Download]
>gi|387903680|ref|NC_017921.1|:1969812-1970183 Burkholderia sp. KJ006 chromosome 2, complete sequence
GTGGACGACTTCGCGTCAGAAGTGCAGGTTTTCCTGTCGGTGCGCGACAACATCGAGCGCATCCTGAATA
GTCGGCGCGGGTCTCTCGCGCACCTTCCGGACTACGGCCTAGACGACCTGTCGGAGATCTATCGGCATCT
GCCGTCCTCGGCGCACAAGCTGCGGCGCGCGATCGAGGCGACCCTGCTCGCTTACGAACCGCGTCTGAAG
CGAATAGAAATCGAAATTCATCCGCCCGAGCCTGGTATGTTGATCAGCTTCACGATGGCCTGTCATTTGC
ATCAGGCAGGGCTCGTGCGCTTCGGCACGAACTTCATGCCGGACGGCAAAACCCGACTGCGCATGCTGCA
GGCAGCGCTCGACCGATACTGA
 Primer design