SecReT6
Protein ID: 387906482
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5749
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]770368..770862 [-]
Productlipoprotein
NoteTssJ
UniProt IDI2DZL2
KEGG IDbuk:MYA_5749
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-40, Aligned region: 9..158
Protein Sequence: 164 a.a.     [Download]
>gi|387906482|ref|YP_006336819.1| lipoprotein [Burkholderia sp. KJ006]
MGAWVMAAALLSGCGMWQSAKETTVDATRAVFTRKVKQMNLVIESRAALNPNERGQSLPVVVRVYQLKDT
KAFEKASYSRLLDDDRELLKADLAGSMEAVLGPGATVELSAPMADEVQAVGVVGFFRDQDGATWQLVIPK
SQWKKTDPVKLIVTGNQIELGANH
 
Nucleotide Sequence: 495 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c770862-770368 Burkholderia sp. KJ006 chromosome 3, complete sequence
GTGGGCGCATGGGTAATGGCCGCTGCACTGCTCTCCGGCTGCGGCATGTGGCAGTCGGCAAAGGAAACGA
CCGTCGACGCAACGCGCGCGGTATTCACCCGCAAGGTCAAGCAGATGAACCTCGTGATCGAGAGCCGCGC
TGCGCTGAATCCGAACGAGCGGGGCCAATCATTGCCCGTCGTAGTGCGCGTTTATCAGTTGAAGGATACG
AAGGCCTTTGAAAAGGCATCCTACAGCCGACTGCTTGACGATGATCGTGAACTGCTGAAGGCCGATCTCG
CCGGCAGCATGGAGGCCGTACTTGGGCCGGGCGCAACGGTCGAGCTGTCGGCGCCGATGGCGGACGAAGT
CCAGGCGGTGGGTGTCGTGGGATTTTTCCGCGATCAGGACGGCGCCACGTGGCAATTGGTGATCCCCAAG
TCCCAGTGGAAGAAAACGGACCCGGTGAAACTCATCGTGACGGGCAACCAGATTGAATTGGGCGCGAACC
ATTGA
 Primer design