SecReT6
Protein ID: 387906483
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5750
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]770901..772721 [-]
ProductType VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDI2DZL3
KEGG IDbuk:MYA_5750
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.70E-126, Aligned region: 13..597
Protein Sequence: 606 a.a.     [Download]
>gi|387906483|ref|YP_006336820.1| Type VI secretion protein, VC_A0110 family [Burkholderia sp. KJ006]
MDAERITQQDDPFLKYFDSEMRYLREAGREFAEAQPQAARQLGMTSPGARDERVEAAYAGFAFLASRLRM
KLDDALPEVTDPLIDHLWPHAGRTIPSLAILQCEPRTGEARILDTLPAGLRVRSTPIGSDATVCVYRTTQ
PVRLLPLEIREAGVRMREDGRTVIRLAFNLLHREQRLLDDLSRIRLYLHGDRPTASALYAVFTRQVESVG
VRMPRVLDGQLQPQPDVRFEAAGFGPDTRLWPVGHGARDAELDREQTLLEYFSFPEKFHFVDLCGFNTAS
VPSGETRMEFEIVIDGRMAGDVTFDADNIRLFCTPVINLFEVDAQAIRPNAHDRDYPVRPPVSAGDHVEP
YDALSVVAADPRNAMQFEYQSFKEFRHRGGMMRYESPERYYHSSIRHGVTGQREMWITLGGHLWDEPDSL
PDGHVTVRVLANNGRLPRMALRESMITEPVSAFAGVERVRNLTAPTMPLYPPRGSEYDWKVVSHFNAMGS
TELNMMDASVLRGALSLYDWSPQDDNRRRIEAIRDVWLDEDTEIVGARVDRIMNVNVGIEPSSFAGPGDV
ALFGDVMSRFVGRYACFHYAVRLVLHEGVGGPVRRYPSAVKAGGWL
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c772721-770901 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGGATGCCGAGCGGATAACGCAGCAAGACGATCCGTTTCTGAAGTATTTCGATTCGGAAATGCGCTACC
TGCGCGAAGCGGGCAGAGAATTCGCCGAAGCGCAGCCACAGGCCGCGCGCCAACTGGGGATGACTTCGCC
CGGTGCACGGGACGAGCGAGTGGAAGCTGCATACGCGGGCTTCGCATTTCTAGCGAGTCGGCTGCGAATG
AAGCTCGATGATGCGCTGCCGGAAGTGACTGATCCGCTGATCGACCATTTGTGGCCGCATGCGGGCCGTA
CCATTCCGTCGCTGGCAATCCTTCAGTGCGAGCCACGCACGGGCGAGGCCCGGATTCTGGATACCTTACC
GGCGGGGCTGCGGGTGCGCTCCACGCCGATTGGGTCCGACGCGACGGTGTGTGTCTATCGCACCACTCAA
CCGGTACGCTTGCTGCCGCTCGAGATCCGCGAAGCCGGCGTGCGGATGCGAGAGGACGGCCGCACGGTGA
TCCGGCTTGCATTCAATCTGCTGCATCGCGAGCAGCGTCTGCTCGACGATCTGTCGCGCATTCGCCTGTA
TCTCCATGGTGATCGGCCGACCGCATCGGCGCTGTATGCAGTGTTCACACGGCAGGTCGAATCGGTCGGT
GTGCGTATGCCACGCGTGCTCGACGGTCAGTTGCAACCACAACCGGATGTGCGTTTCGAGGCGGCCGGAT
TCGGTCCCGATACGCGATTGTGGCCGGTCGGCCACGGCGCCCGCGACGCCGAGCTCGATCGTGAACAGAC
ACTGCTCGAGTATTTCTCGTTCCCGGAAAAATTCCACTTCGTCGACCTCTGCGGATTCAACACGGCAAGC
GTGCCGTCCGGTGAGACGCGCATGGAGTTCGAGATCGTGATCGACGGCCGCATGGCCGGCGACGTGACGT
TCGACGCGGACAATATCCGTCTGTTCTGCACGCCGGTGATCAACCTGTTCGAAGTGGATGCGCAGGCGAT
TCGCCCCAATGCCCATGACCGCGATTATCCGGTACGTCCACCTGTTTCCGCTGGCGATCATGTCGAGCCC
TACGACGCCTTGTCGGTCGTGGCAGCCGATCCTCGCAATGCGATGCAATTCGAATACCAGTCGTTCAAGG
AGTTTCGGCACCGCGGCGGGATGATGCGCTACGAGTCGCCCGAGCGCTATTACCACTCGTCGATTCGTCA
CGGCGTTACCGGCCAGCGAGAGATGTGGATCACGCTCGGCGGCCATCTATGGGATGAACCCGACAGCCTG
CCGGACGGGCACGTAACGGTTCGGGTGCTGGCAAATAATGGCCGTTTGCCGCGTATGGCGCTACGCGAAT
CGATGATTACCGAGCCGGTATCGGCGTTTGCTGGTGTCGAGCGGGTGCGCAATCTCACGGCGCCGACGAT
GCCGCTTTATCCGCCGCGTGGCAGCGAATACGACTGGAAAGTCGTTTCACACTTCAATGCGATGGGTTCG
ACTGAACTCAACATGATGGATGCGAGTGTGCTGCGCGGTGCGCTGTCGCTGTACGACTGGTCGCCACAGG
ACGATAACCGGCGGCGTATCGAGGCGATTCGCGATGTGTGGCTGGACGAAGACACTGAAATCGTGGGTGC
ACGCGTCGACAGAATCATGAACGTGAATGTTGGCATCGAGCCATCGAGCTTCGCCGGTCCGGGCGATGTC
GCGCTGTTCGGCGACGTGATGAGCCGCTTCGTCGGTCGTTACGCCTGTTTCCATTACGCGGTGCGACTCG
TGCTGCATGAAGGTGTGGGTGGACCGGTTCGCCGTTATCCAAGCGCAGTCAAGGCGGGAGGTTGGTTGTG
A
 Primer design