SecReT6
Protein ID: 387906485
SecReT6 ID661
T6SS typei2
Gene symbol-
Locus tagMYA_5753
StrainBurkholderia sp. KJ006
Repliconchromosome III [GenBank: NC_017922] [Browse all T6SS(s) in this replicon]
Location [Strand]777712..777894 [-]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDI2DZL5
KEGG IDbuk:MYA_5753
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 5.70E-13, Aligned region: 1..53
Protein Sequence: 60 a.a.     [Download]
>gi|387906485|ref|YP_006336822.1| PAAR repeat-containing protein [Burkholderia sp. KJ006]
MGRPLARKGDAALCDRHGETVIDEGDESFPDQDGRPVAMHLHRCACGCRLISSLQNVHIG
 
Nucleotide Sequence: 183 bp     [Download]
>gi|387905813|ref|NC_017922.1|:c777894-777712 Burkholderia sp. KJ006 chromosome 3, complete sequence
ATGGGCCGACCGCTGGCCCGCAAAGGCGATGCTGCGCTCTGTGACCGGCACGGCGAAACCGTCATCGATG
AGGGCGACGAATCGTTTCCTGACCAGGACGGCAGGCCAGTGGCGATGCATCTGCATCGTTGTGCGTGCGG
CTGTCGGCTGATCTCGTCGTTGCAGAACGTACACATCGGCTGA
 Primer design